data_2YQP # _entry.id 2YQP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YQP pdb_00002yqp 10.2210/pdb2yqp/pdb RCSB RCSB027013 ? ? WWPDB D_1000027013 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso003013101.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2YQP _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-03-30 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Tarada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the zf-HIT domain in DEAD (Asp-Glu-Ala-Asp) box polypeptide 59' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Tarada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Probable ATP-dependent RNA helicase DDX59' 6637.442 1 3.6.1.- ? 'zf-HIT domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DEAD box protein 59, Zinc finger HIT domain-containing protein 5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGFSKTQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGFSKTQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso003013101.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PHE n 1 9 SER n 1 10 LYS n 1 11 THR n 1 12 GLN n 1 13 ARG n 1 14 TRP n 1 15 ALA n 1 16 GLU n 1 17 PRO n 1 18 GLY n 1 19 GLU n 1 20 PRO n 1 21 ILE n 1 22 CYS n 1 23 VAL n 1 24 VAL n 1 25 CYS n 1 26 GLY n 1 27 ARG n 1 28 TYR n 1 29 GLY n 1 30 GLU n 1 31 TYR n 1 32 ILE n 1 33 CYS n 1 34 ASP n 1 35 LYS n 1 36 THR n 1 37 ASP n 1 38 GLU n 1 39 ASP n 1 40 VAL n 1 41 CYS n 1 42 SER n 1 43 LEU n 1 44 GLU n 1 45 CYS n 1 46 LYS n 1 47 ALA n 1 48 LYS n 1 49 HIS n 1 50 LEU n 1 51 LEU n 1 52 GLN n 1 53 VAL n 1 54 LYS n 1 55 GLU n 1 56 LYS n 1 57 GLU n 1 58 GLU n 1 59 LYS n 1 60 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene RP11-92G12.2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060925-04 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DDX59_HUMAN _struct_ref.pdbx_db_accession Q5T1V6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code FSKTQRWAEPGEPICVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEKEEKS _struct_ref.pdbx_align_begin 94 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YQP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5T1V6 _struct_ref_seq.db_align_beg 94 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 60 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YQP GLY A 1 ? UNP Q5T1V6 ? ? 'expression tag' 1 1 1 2YQP SER A 2 ? UNP Q5T1V6 ? ? 'expression tag' 2 2 1 2YQP SER A 3 ? UNP Q5T1V6 ? ? 'expression tag' 3 3 1 2YQP GLY A 4 ? UNP Q5T1V6 ? ? 'expression tag' 4 4 1 2YQP SER A 5 ? UNP Q5T1V6 ? ? 'expression tag' 5 5 1 2YQP SER A 6 ? UNP Q5T1V6 ? ? 'expression tag' 6 6 1 2YQP GLY A 7 ? UNP Q5T1V6 ? ? 'expression tag' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0mM 13C, 15N-labeled protein; 20mM d-Tris-HCl (pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2YQP _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.entry_id 2YQP _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2YQP # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.1 'Guntert, P.' 5 refinement CYANA 2.1 'Guntert, P.' 6 # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2YQP _exptl.crystals_number ? # _struct.entry_id 2YQP _struct.title 'Solution structure of the zf-HIT domain in DEAD (Asp-Glu-Ala-Asp) box polypeptide 59' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YQP _struct_keywords.text ;structure genomics, zf-HIT domain, DEAD box polypeptide 59 isoform 2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION, HYDROLASE ; _struct_keywords.pdbx_keywords 'GENE REGULATION, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LEU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 43 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 57 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LEU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 43 _struct_conf.end_auth_comp_id GLU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 57 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 22 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 22 A ZN 201 1_555 ? ? ? ? ? ? ? 2.241 ? ? metalc2 metalc ? ? A CYS 25 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 25 A ZN 201 1_555 ? ? ? ? ? ? ? 2.356 ? ? metalc3 metalc ? ? A CYS 41 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 41 A ZN 201 1_555 ? ? ? ? ? ? ? 2.219 ? ? metalc4 metalc ? ? A CYS 45 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 45 A ZN 201 1_555 ? ? ? ? ? ? ? 2.351 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 31 ? ILE A 32 ? TYR A 31 ILE A 32 A 2 ASP A 39 ? VAL A 40 ? ASP A 39 VAL A 40 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 31 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 31 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 40 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 40 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 22 ? CYS A 22 . ? 1_555 ? 2 AC1 4 CYS A 25 ? CYS A 25 . ? 1_555 ? 3 AC1 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 4 AC1 4 CYS A 45 ? CYS A 45 . ? 1_555 ? # _atom_sites.entry_id 2YQP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 SER 60 60 60 SER SER A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 22 ? A CYS 22 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 25 ? A CYS 25 ? 1_555 104.9 ? 2 SG ? A CYS 22 ? A CYS 22 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 119.6 ? 3 SG ? A CYS 25 ? A CYS 25 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 115.0 ? 4 SG ? A CYS 22 ? A CYS 22 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 107.0 ? 5 SG ? A CYS 25 ? A CYS 25 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 101.6 ? 6 SG ? A CYS 41 ? A CYS 41 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 106.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -154.10 -42.17 2 1 SER A 3 ? ? 61.28 178.07 3 1 THR A 11 ? ? -99.66 37.82 4 1 PRO A 17 ? ? -69.81 79.41 5 1 CYS A 25 ? ? -96.11 -79.08 6 1 ARG A 27 ? ? -139.34 -71.04 7 1 CYS A 33 ? ? -69.92 -176.94 8 1 GLU A 38 ? ? -64.61 -169.50 9 1 GLU A 58 ? ? 63.05 165.21 10 1 LYS A 59 ? ? 63.09 162.91 11 2 SER A 2 ? ? -168.63 106.84 12 2 SER A 3 ? ? 63.14 165.20 13 2 SER A 5 ? ? -152.87 -73.93 14 2 LYS A 10 ? ? -142.44 -48.13 15 2 GLN A 12 ? ? -108.74 79.94 16 2 PRO A 17 ? ? -69.74 80.25 17 2 CYS A 25 ? ? -94.61 -79.30 18 2 ARG A 27 ? ? -139.97 -69.96 19 2 CYS A 33 ? ? -69.88 -178.12 20 2 GLU A 38 ? ? -63.70 -169.47 21 2 GLU A 58 ? ? 62.98 -176.60 22 3 SER A 2 ? ? -174.77 124.74 23 3 SER A 6 ? ? 62.60 169.14 24 3 CYS A 25 ? ? -96.78 -79.17 25 3 ARG A 27 ? ? -138.49 -71.29 26 3 CYS A 33 ? ? -69.91 -176.59 27 3 LYS A 35 ? ? -51.80 -74.54 28 3 GLU A 38 ? ? -61.95 -174.64 29 4 SER A 9 ? ? 63.12 171.01 30 4 PRO A 17 ? ? -69.82 78.74 31 4 CYS A 25 ? ? -94.07 -79.13 32 4 ARG A 27 ? ? -140.80 -70.77 33 4 CYS A 33 ? ? -69.85 -176.97 34 4 LYS A 35 ? ? -51.67 -74.49 35 4 GLU A 38 ? ? -61.05 -174.95 36 5 SER A 5 ? ? -61.14 96.34 37 5 SER A 6 ? ? 58.23 178.22 38 5 TRP A 14 ? ? -55.70 176.25 39 5 PRO A 17 ? ? -69.71 78.46 40 5 CYS A 25 ? ? -91.72 -78.93 41 5 ARG A 27 ? ? -138.90 -74.54 42 5 CYS A 33 ? ? -69.94 -178.15 43 5 LYS A 35 ? ? -51.69 -72.42 44 5 GLU A 38 ? ? -66.37 -175.84 45 6 PHE A 8 ? ? -169.87 34.95 46 6 SER A 9 ? ? -154.76 41.89 47 6 LYS A 10 ? ? 61.55 93.91 48 6 PRO A 17 ? ? -69.74 78.71 49 6 CYS A 25 ? ? -94.41 -79.41 50 6 ARG A 27 ? ? -135.45 -71.85 51 6 LYS A 35 ? ? -51.73 -71.22 52 6 GLU A 38 ? ? -69.31 -175.77 53 6 GLU A 58 ? ? 63.33 -172.04 54 7 SER A 9 ? ? -154.29 28.61 55 7 LYS A 10 ? ? 59.13 -175.64 56 7 PRO A 17 ? ? -69.77 78.64 57 7 CYS A 25 ? ? -97.21 -79.75 58 7 ARG A 27 ? ? -136.55 -73.18 59 7 LYS A 35 ? ? -51.74 -70.78 60 7 GLU A 58 ? ? 59.42 90.36 61 8 SER A 6 ? ? 62.29 175.95 62 8 SER A 9 ? ? 61.72 -174.07 63 8 TRP A 14 ? ? -53.54 170.93 64 8 PRO A 17 ? ? -69.75 78.78 65 8 CYS A 25 ? ? -97.51 -79.89 66 8 ARG A 27 ? ? -138.04 -73.58 67 8 CYS A 33 ? ? -69.91 -175.80 68 8 GLU A 38 ? ? -65.62 -169.87 69 9 SER A 2 ? ? -101.39 43.64 70 9 SER A 3 ? ? 57.73 92.94 71 9 SER A 5 ? ? -173.24 -59.91 72 9 SER A 6 ? ? 62.14 170.18 73 9 GLN A 12 ? ? -141.07 54.72 74 9 CYS A 25 ? ? -92.34 -79.08 75 9 ARG A 27 ? ? -138.28 -74.66 76 9 CYS A 33 ? ? -69.89 -176.51 77 9 GLU A 38 ? ? -67.09 -175.78 78 9 GLU A 58 ? ? -69.54 92.51 79 10 PHE A 8 ? ? -156.69 -71.42 80 10 LYS A 10 ? ? -164.49 93.23 81 10 PRO A 17 ? ? -69.73 78.56 82 10 CYS A 25 ? ? -92.14 -79.11 83 10 ARG A 27 ? ? -139.65 -73.55 84 10 LYS A 35 ? ? -51.65 -73.05 85 10 GLU A 38 ? ? -66.95 -175.70 86 11 SER A 6 ? ? -170.85 118.47 87 11 THR A 11 ? ? -55.42 170.58 88 11 TRP A 14 ? ? -57.77 -179.56 89 11 PRO A 17 ? ? -69.75 80.26 90 11 CYS A 25 ? ? -94.05 -79.19 91 11 ARG A 27 ? ? -138.92 -68.11 92 11 CYS A 33 ? ? -69.81 -176.37 93 11 GLU A 38 ? ? -64.85 -169.54 94 11 GLU A 58 ? ? 63.21 81.46 95 12 SER A 2 ? ? 62.95 102.37 96 12 SER A 3 ? ? -172.37 129.55 97 12 PHE A 8 ? ? 61.71 98.54 98 12 GLN A 12 ? ? -112.93 58.92 99 12 TRP A 14 ? ? -57.28 179.19 100 12 PRO A 17 ? ? -69.79 78.76 101 12 CYS A 25 ? ? -92.50 -79.07 102 12 ARG A 27 ? ? -140.58 -72.14 103 12 CYS A 33 ? ? -69.98 -176.42 104 12 LYS A 35 ? ? -51.76 -70.45 105 12 GLU A 38 ? ? -67.23 -175.66 106 12 LYS A 59 ? ? 55.49 -175.04 107 13 LYS A 10 ? ? -167.24 -74.43 108 13 THR A 11 ? ? -160.34 68.71 109 13 CYS A 25 ? ? -96.99 -79.02 110 13 ARG A 27 ? ? -138.60 -73.87 111 13 CYS A 33 ? ? -69.92 -179.15 112 13 LYS A 35 ? ? -51.81 -74.60 113 13 GLU A 58 ? ? 51.23 73.48 114 14 THR A 11 ? ? -85.99 -74.17 115 14 PRO A 17 ? ? -69.77 80.96 116 14 CYS A 25 ? ? -100.14 -79.54 117 14 ARG A 27 ? ? -138.80 -74.44 118 14 CYS A 33 ? ? -69.86 -175.89 119 14 GLU A 38 ? ? -64.18 -169.78 120 14 GLU A 58 ? ? 72.33 -68.85 121 14 LYS A 59 ? ? 51.99 73.51 122 15 SER A 9 ? ? 61.71 173.72 123 15 LYS A 10 ? ? -166.11 97.56 124 15 THR A 11 ? ? -167.02 105.07 125 15 PRO A 17 ? ? -69.77 78.36 126 15 CYS A 25 ? ? -94.76 -79.20 127 15 ARG A 27 ? ? -140.03 -73.30 128 15 CYS A 33 ? ? -69.85 -176.20 129 15 GLU A 38 ? ? -63.37 -169.40 130 16 SER A 2 ? ? -140.97 -66.73 131 16 SER A 3 ? ? 62.35 71.69 132 16 SER A 9 ? ? -166.66 32.86 133 16 LYS A 10 ? ? -148.14 36.82 134 16 GLN A 12 ? ? 51.93 72.54 135 16 CYS A 25 ? ? -96.31 -79.39 136 16 ARG A 27 ? ? -141.20 -72.83 137 16 CYS A 33 ? ? -69.90 -176.21 138 16 GLU A 38 ? ? -64.19 -169.48 139 16 GLU A 58 ? ? -90.45 50.37 140 16 LYS A 59 ? ? -147.44 -70.87 141 17 SER A 9 ? ? -164.44 59.08 142 17 THR A 11 ? ? -163.41 -40.16 143 17 CYS A 25 ? ? -97.45 -79.23 144 17 ARG A 27 ? ? -142.70 -73.84 145 17 CYS A 33 ? ? -69.86 -175.98 146 17 GLU A 38 ? ? -64.98 -169.52 147 18 SER A 9 ? ? 53.62 -171.17 148 18 THR A 11 ? ? -158.46 43.25 149 18 CYS A 25 ? ? -97.01 -79.28 150 18 ARG A 27 ? ? -139.17 -70.29 151 18 CYS A 33 ? ? -69.99 -176.34 152 18 LYS A 35 ? ? -51.76 -74.54 153 18 GLU A 38 ? ? -60.55 -175.32 154 18 GLU A 58 ? ? 62.01 84.65 155 19 SER A 6 ? ? -135.14 -63.75 156 19 SER A 9 ? ? -158.40 28.33 157 19 THR A 11 ? ? 72.50 -68.73 158 19 CYS A 25 ? ? -95.99 -79.33 159 19 ARG A 27 ? ? -133.76 -74.84 160 19 CYS A 33 ? ? -69.80 -177.02 161 19 GLU A 38 ? ? -63.44 -169.78 162 20 SER A 6 ? ? -107.74 -63.34 163 20 THR A 11 ? ? -96.82 31.03 164 20 PRO A 17 ? ? -69.74 78.41 165 20 CYS A 25 ? ? -90.64 -78.85 166 20 ARG A 27 ? ? -140.56 -73.00 167 20 CYS A 33 ? ? -69.92 -178.57 168 20 LYS A 35 ? ? -51.64 -74.17 169 20 GLU A 38 ? ? -65.51 -175.96 170 20 GLU A 58 ? ? -107.76 75.93 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #