data_2YRD # _entry.id 2YRD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YRD pdb_00002yrd 10.2210/pdb2yrd/pdb RCSB RCSB027037 ? ? WWPDB D_1000027037 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002022249.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2YRD _pdbx_database_status.recvd_initial_deposition_date 2007-04-02 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nagashima, T.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the zf-Sec23_Sec24 from human Sec23A mutant V69A' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nagashima, T.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein transport protein Sec23A' 6433.213 1 ? V69A zf-Sec23_Sec24 ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SEC23-related protein A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGEPVLCSRTTCRAALNPLCQVDYRAKLWACNFCYQRNQFPPSYAGISELNQPA _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGEPVLCSRTTCRAALNPLCQVDYRAKLWACNFCYQRNQFPPSYAGISELNQPA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002022249.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 PRO n 1 10 VAL n 1 11 LEU n 1 12 CYS n 1 13 SER n 1 14 ARG n 1 15 THR n 1 16 THR n 1 17 CYS n 1 18 ARG n 1 19 ALA n 1 20 ALA n 1 21 LEU n 1 22 ASN n 1 23 PRO n 1 24 LEU n 1 25 CYS n 1 26 GLN n 1 27 VAL n 1 28 ASP n 1 29 TYR n 1 30 ARG n 1 31 ALA n 1 32 LYS n 1 33 LEU n 1 34 TRP n 1 35 ALA n 1 36 CYS n 1 37 ASN n 1 38 PHE n 1 39 CYS n 1 40 TYR n 1 41 GLN n 1 42 ARG n 1 43 ASN n 1 44 GLN n 1 45 PHE n 1 46 PRO n 1 47 PRO n 1 48 SER n 1 49 TYR n 1 50 ALA n 1 51 GLY n 1 52 ILE n 1 53 SER n 1 54 GLU n 1 55 LEU n 1 56 ASN n 1 57 GLN n 1 58 PRO n 1 59 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene SEC23A _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060613-07 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SC23A_HUMAN _struct_ref.pdbx_db_accession Q15436 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EPVLCSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPSYAGISELNQPA _struct_ref.pdbx_align_begin 57 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YRD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 59 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q15436 _struct_ref_seq.db_align_beg 57 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 57 _struct_ref_seq.pdbx_auth_seq_align_end 108 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YRD GLY A 1 ? UNP Q15436 ? ? 'expression tag' 50 1 1 2YRD SER A 2 ? UNP Q15436 ? ? 'expression tag' 51 2 1 2YRD SER A 3 ? UNP Q15436 ? ? 'expression tag' 52 3 1 2YRD GLY A 4 ? UNP Q15436 ? ? 'expression tag' 53 4 1 2YRD SER A 5 ? UNP Q15436 ? ? 'expression tag' 54 5 1 2YRD SER A 6 ? UNP Q15436 ? ? 'expression tag' 55 6 1 2YRD GLY A 7 ? UNP Q15436 ? ? 'expression tag' 56 7 1 2YRD ALA A 20 ? UNP Q15436 VAL 69 'engineered mutation' 69 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.12mM uniformly 13C, 15N-labeled protein; 20mM TrisHCl, 100mM NaCl, 1mM DTT, 0.02% NaN3, 0.05mM ZnCl2, 1mM IDA, 10% D2O, 90% H2O' _pdbx_nmr_sample_details.solvent_system '10% D2O, 90% H2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2YRD _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2YRD _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2YRD _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20020425 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9822 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2YRD _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2YRD _struct.title 'Solution structure of the zf-Sec23_Sec24 from human Sec23A mutant V69A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YRD _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' _struct_keywords.text ;zinc binding, COPII, coat protein complex-II, endoplasmic reticulum, Golgi, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN TRANSPORT ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ILE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 52 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 57 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ILE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 101 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 106 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 12 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 61 A ZN 200 1_555 ? ? ? ? ? ? ? 2.289 ? ? metalc2 metalc ? ? A CYS 17 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 66 A ZN 200 1_555 ? ? ? ? ? ? ? 2.262 ? ? metalc3 metalc ? ? A CYS 36 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 85 A ZN 200 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc4 metalc ? ? A CYS 39 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 88 A ZN 200 1_555 ? ? ? ? ? ? ? 2.277 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 26 ? ASP A 28 ? GLN A 75 ASP A 77 A 2 LEU A 33 ? ALA A 35 ? LEU A 82 ALA A 84 A 3 ARG A 42 ? GLN A 44 ? ARG A 91 GLN A 93 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLN A 26 ? N GLN A 75 O ALA A 35 ? O ALA A 84 A 2 3 N TRP A 34 ? N TRP A 83 O ASN A 43 ? O ASN A 92 # _database_PDB_matrix.entry_id 2YRD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2YRD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 50 50 GLY GLY A . n A 1 2 SER 2 51 51 SER SER A . n A 1 3 SER 3 52 52 SER SER A . n A 1 4 GLY 4 53 53 GLY GLY A . n A 1 5 SER 5 54 54 SER SER A . n A 1 6 SER 6 55 55 SER SER A . n A 1 7 GLY 7 56 56 GLY GLY A . n A 1 8 GLU 8 57 57 GLU GLU A . n A 1 9 PRO 9 58 58 PRO PRO A . n A 1 10 VAL 10 59 59 VAL VAL A . n A 1 11 LEU 11 60 60 LEU LEU A . n A 1 12 CYS 12 61 61 CYS CYS A . n A 1 13 SER 13 62 62 SER SER A . n A 1 14 ARG 14 63 63 ARG ARG A . n A 1 15 THR 15 64 64 THR THR A . n A 1 16 THR 16 65 65 THR THR A . n A 1 17 CYS 17 66 66 CYS CYS A . n A 1 18 ARG 18 67 67 ARG ARG A . n A 1 19 ALA 19 68 68 ALA ALA A . n A 1 20 ALA 20 69 69 ALA ALA A . n A 1 21 LEU 21 70 70 LEU LEU A . n A 1 22 ASN 22 71 71 ASN ASN A . n A 1 23 PRO 23 72 72 PRO PRO A . n A 1 24 LEU 24 73 73 LEU LEU A . n A 1 25 CYS 25 74 74 CYS CYS A . n A 1 26 GLN 26 75 75 GLN GLN A . n A 1 27 VAL 27 76 76 VAL VAL A . n A 1 28 ASP 28 77 77 ASP ASP A . n A 1 29 TYR 29 78 78 TYR TYR A . n A 1 30 ARG 30 79 79 ARG ARG A . n A 1 31 ALA 31 80 80 ALA ALA A . n A 1 32 LYS 32 81 81 LYS LYS A . n A 1 33 LEU 33 82 82 LEU LEU A . n A 1 34 TRP 34 83 83 TRP TRP A . n A 1 35 ALA 35 84 84 ALA ALA A . n A 1 36 CYS 36 85 85 CYS CYS A . n A 1 37 ASN 37 86 86 ASN ASN A . n A 1 38 PHE 38 87 87 PHE PHE A . n A 1 39 CYS 39 88 88 CYS CYS A . n A 1 40 TYR 40 89 89 TYR TYR A . n A 1 41 GLN 41 90 90 GLN GLN A . n A 1 42 ARG 42 91 91 ARG ARG A . n A 1 43 ASN 43 92 92 ASN ASN A . n A 1 44 GLN 44 93 93 GLN GLN A . n A 1 45 PHE 45 94 94 PHE PHE A . n A 1 46 PRO 46 95 95 PRO PRO A . n A 1 47 PRO 47 96 96 PRO PRO A . n A 1 48 SER 48 97 97 SER SER A . n A 1 49 TYR 49 98 98 TYR TYR A . n A 1 50 ALA 50 99 99 ALA ALA A . n A 1 51 GLY 51 100 100 GLY GLY A . n A 1 52 ILE 52 101 101 ILE ILE A . n A 1 53 SER 53 102 102 SER SER A . n A 1 54 GLU 54 103 103 GLU GLU A . n A 1 55 LEU 55 104 104 LEU LEU A . n A 1 56 ASN 56 105 105 ASN ASN A . n A 1 57 GLN 57 106 106 GLN GLN A . n A 1 58 PRO 58 107 107 PRO PRO A . n A 1 59 ALA 59 108 108 ALA ALA A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 200 _pdbx_nonpoly_scheme.auth_seq_num 200 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 12 ? A CYS 61 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 17 ? A CYS 66 ? 1_555 114.3 ? 2 SG ? A CYS 12 ? A CYS 61 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 36 ? A CYS 85 ? 1_555 111.6 ? 3 SG ? A CYS 17 ? A CYS 66 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 36 ? A CYS 85 ? 1_555 104.9 ? 4 SG ? A CYS 12 ? A CYS 61 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 39 ? A CYS 88 ? 1_555 106.2 ? 5 SG ? A CYS 17 ? A CYS 66 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 39 ? A CYS 88 ? 1_555 115.1 ? 6 SG ? A CYS 36 ? A CYS 85 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 39 ? A CYS 88 ? 1_555 104.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 61 ? ? -39.42 149.93 2 1 PRO A 72 ? ? -69.80 0.85 3 1 LYS A 81 ? ? 34.72 46.43 4 1 PHE A 87 ? ? -103.86 -74.95 5 1 SER A 97 ? ? -110.33 58.83 6 1 TYR A 98 ? ? -86.74 45.78 7 1 ILE A 101 ? ? -40.19 109.36 8 2 GLN A 75 ? ? -59.15 105.10 9 2 PHE A 87 ? ? -100.62 -72.62 10 2 ALA A 99 ? ? -37.86 132.60 11 3 CYS A 61 ? ? -34.90 149.62 12 3 CYS A 66 ? ? -79.33 -70.33 13 3 ALA A 69 ? ? -42.11 155.58 14 3 PRO A 72 ? ? -69.78 0.77 15 3 TYR A 78 ? ? -37.82 -30.31 16 3 LYS A 81 ? ? 34.91 43.69 17 3 PHE A 87 ? ? -107.12 -73.87 18 3 ASN A 105 ? ? -105.31 -66.53 19 4 ARG A 67 ? ? 37.49 44.59 20 4 PRO A 72 ? ? -69.77 2.79 21 4 ASP A 77 ? ? -104.21 70.75 22 4 LYS A 81 ? ? 35.11 41.52 23 4 PHE A 87 ? ? -99.99 -74.68 24 4 TYR A 98 ? ? -85.47 37.48 25 5 SER A 52 ? ? -81.21 42.92 26 5 ARG A 67 ? ? 37.98 41.82 27 5 CYS A 74 ? ? -48.37 165.57 28 5 ASP A 77 ? ? -117.32 70.70 29 5 LYS A 81 ? ? 36.11 37.65 30 5 PHE A 87 ? ? -101.76 -74.93 31 5 ILE A 101 ? ? -36.76 111.96 32 6 SER A 51 ? ? 70.54 42.69 33 6 CYS A 66 ? ? -85.75 -70.40 34 6 TYR A 78 ? ? -37.65 -32.17 35 6 PHE A 87 ? ? -113.41 -75.18 36 7 ARG A 63 ? ? -47.93 109.60 37 7 ALA A 69 ? ? -53.73 172.64 38 7 GLN A 75 ? ? -66.81 88.25 39 7 ASP A 77 ? ? -113.84 70.72 40 7 LYS A 81 ? ? 34.11 49.91 41 7 PHE A 87 ? ? -98.33 -75.26 42 7 ILE A 101 ? ? -38.58 133.78 43 7 GLN A 106 ? ? 34.43 54.17 44 8 SER A 51 ? ? -53.80 104.39 45 8 ARG A 67 ? ? 39.65 42.73 46 8 GLN A 75 ? ? -64.31 97.88 47 8 ASP A 77 ? ? -113.00 72.81 48 8 LYS A 81 ? ? 34.83 37.41 49 8 PHE A 87 ? ? -96.89 -75.13 50 8 LEU A 104 ? ? -85.18 44.20 51 9 ARG A 63 ? ? -37.11 126.92 52 9 ARG A 67 ? ? 35.53 41.16 53 9 GLN A 75 ? ? -64.17 99.94 54 9 ASP A 77 ? ? -108.02 79.57 55 9 TYR A 78 ? ? -34.10 -33.55 56 9 LYS A 81 ? ? 36.37 51.10 57 9 PHE A 87 ? ? -96.99 -75.02 58 9 SER A 97 ? ? -86.94 39.68 59 9 TYR A 98 ? ? -84.43 35.87 60 9 ALA A 99 ? ? -93.46 42.77 61 10 SER A 52 ? ? -52.68 103.18 62 10 CYS A 74 ? ? -45.89 154.59 63 10 LYS A 81 ? ? 36.16 50.71 64 10 PHE A 87 ? ? -99.21 -72.11 65 11 ARG A 63 ? ? -44.90 158.57 66 11 CYS A 66 ? ? -104.84 -65.67 67 11 PRO A 72 ? ? -69.68 2.91 68 11 ASP A 77 ? ? -105.92 55.67 69 11 LYS A 81 ? ? 34.26 43.18 70 11 PHE A 87 ? ? -89.15 -75.59 71 12 CYS A 61 ? ? -34.96 149.49 72 12 CYS A 66 ? ? -79.67 -71.75 73 12 PRO A 72 ? ? -69.77 1.39 74 12 ASP A 77 ? ? -95.56 54.44 75 12 TYR A 78 ? ? -34.64 -39.13 76 12 ALA A 80 ? ? -98.57 30.41 77 12 LYS A 81 ? ? 34.35 39.17 78 12 PHE A 87 ? ? -85.98 -75.57 79 12 TYR A 89 ? ? 73.44 48.29 80 12 ALA A 99 ? ? -108.50 41.02 81 13 CYS A 61 ? ? -45.17 162.84 82 13 CYS A 66 ? ? -90.18 -64.49 83 13 ARG A 67 ? ? 37.37 42.59 84 13 LYS A 81 ? ? 37.71 42.69 85 13 PHE A 87 ? ? -97.85 -75.03 86 14 SER A 54 ? ? -58.56 87.20 87 14 LYS A 81 ? ? 35.31 42.14 88 14 PHE A 87 ? ? -100.10 -75.05 89 14 TYR A 89 ? ? 71.52 52.82 90 14 ALA A 99 ? ? -73.39 -71.53 91 15 ARG A 67 ? ? 36.45 44.40 92 15 ASP A 77 ? ? -100.85 72.56 93 15 LYS A 81 ? ? 34.75 47.94 94 15 PHE A 87 ? ? -97.74 -75.12 95 16 ARG A 67 ? ? 37.53 41.64 96 16 ASP A 77 ? ? -92.89 58.76 97 16 TYR A 78 ? ? -34.49 -39.91 98 16 LYS A 81 ? ? 34.44 43.01 99 16 PHE A 87 ? ? -104.50 -74.99 100 16 SER A 97 ? ? -90.16 41.97 101 17 SER A 51 ? ? -37.37 133.71 102 17 SER A 55 ? ? -37.03 120.89 103 17 ARG A 67 ? ? 37.15 41.24 104 17 ALA A 69 ? ? -52.40 171.64 105 17 ASP A 77 ? ? -91.54 53.82 106 17 TYR A 78 ? ? -34.36 -37.54 107 17 ALA A 80 ? ? -96.97 32.53 108 17 LYS A 81 ? ? 34.88 45.19 109 17 PHE A 87 ? ? -87.20 -75.63 110 17 TYR A 89 ? ? 72.21 50.30 111 17 SER A 97 ? ? -107.78 52.78 112 17 TYR A 98 ? ? -82.07 45.44 113 17 ILE A 101 ? ? -34.97 134.17 114 17 LEU A 104 ? ? -69.43 -70.72 115 18 CYS A 66 ? ? -91.02 -67.02 116 18 PRO A 72 ? ? -69.77 1.22 117 18 PHE A 87 ? ? -96.99 -75.09 118 18 SER A 97 ? ? -91.00 45.96 119 18 TYR A 98 ? ? -81.99 39.02 120 19 SER A 54 ? ? -64.00 93.79 121 19 CYS A 66 ? ? -80.63 -70.03 122 19 ALA A 69 ? ? -40.67 162.03 123 19 PRO A 72 ? ? -69.74 1.72 124 19 ASP A 77 ? ? -90.52 52.70 125 19 ALA A 80 ? ? -90.78 33.92 126 19 LYS A 81 ? ? 34.43 36.62 127 19 PHE A 87 ? ? -97.43 -74.90 128 19 TYR A 98 ? ? -98.96 41.81 129 20 PHE A 87 ? ? -97.92 -73.60 130 20 ALA A 99 ? ? -100.12 -60.52 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #