data_2YRE # _entry.id 2YRE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YRE pdb_00002yre 10.2210/pdb2yre/pdb RCSB RCSB027038 ? ? WWPDB D_1000027038 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002010846.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2YRE _pdbx_database_status.recvd_initial_deposition_date 2007-04-02 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nagashima, T.' 1 'Suetake, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the zinc finger domains (1-87) from human F-box only protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nagashima, T.' 1 ? primary 'Suetake, T.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'F-box only protein 30' 10699.260 1 ? ? 'zf-TRAF domain' ? 2 non-polymer syn 'ZINC ION' 65.409 4 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGMEEELQHSHCVNCVSRRCMTRPEPGISCDLIGCPLVCGAVFHSCKADEHRLLCPFERVPCLNSDFGCPFTMAR NKVAEHLEMCPASVSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGMEEELQHSHCVNCVSRRCMTRPEPGISCDLIGCPLVCGAVFHSCKADEHRLLCPFERVPCLNSDFGCPFTMAR NKVAEHLEMCPASVSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002010846.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 GLU n 1 10 GLU n 1 11 GLU n 1 12 LEU n 1 13 GLN n 1 14 HIS n 1 15 SER n 1 16 HIS n 1 17 CYS n 1 18 VAL n 1 19 ASN n 1 20 CYS n 1 21 VAL n 1 22 SER n 1 23 ARG n 1 24 ARG n 1 25 CYS n 1 26 MET n 1 27 THR n 1 28 ARG n 1 29 PRO n 1 30 GLU n 1 31 PRO n 1 32 GLY n 1 33 ILE n 1 34 SER n 1 35 CYS n 1 36 ASP n 1 37 LEU n 1 38 ILE n 1 39 GLY n 1 40 CYS n 1 41 PRO n 1 42 LEU n 1 43 VAL n 1 44 CYS n 1 45 GLY n 1 46 ALA n 1 47 VAL n 1 48 PHE n 1 49 HIS n 1 50 SER n 1 51 CYS n 1 52 LYS n 1 53 ALA n 1 54 ASP n 1 55 GLU n 1 56 HIS n 1 57 ARG n 1 58 LEU n 1 59 LEU n 1 60 CYS n 1 61 PRO n 1 62 PHE n 1 63 GLU n 1 64 ARG n 1 65 VAL n 1 66 PRO n 1 67 CYS n 1 68 LEU n 1 69 ASN n 1 70 SER n 1 71 ASP n 1 72 PHE n 1 73 GLY n 1 74 CYS n 1 75 PRO n 1 76 PHE n 1 77 THR n 1 78 MET n 1 79 ALA n 1 80 ARG n 1 81 ASN n 1 82 LYS n 1 83 VAL n 1 84 ALA n 1 85 GLU n 1 86 HIS n 1 87 LEU n 1 88 GLU n 1 89 MET n 1 90 CYS n 1 91 PRO n 1 92 ALA n 1 93 SER n 1 94 VAL n 1 95 SER n 1 96 GLY n 1 97 PRO n 1 98 SER n 1 99 SER n 1 100 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'FBXO30, FBX30' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050302-79 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FBX30_HUMAN _struct_ref.pdbx_db_accession Q8TB52 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEEELQHSHCVNCVSRRCMTRPEPGISCDLIGCPLVCGAVFHSCKADEHRLLCPFERVPCLNSDFGCPFTMARNKVAEHL EMCPASV ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YRE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 94 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8TB52 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 87 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YRE GLY A 1 ? UNP Q8TB52 ? ? 'expression tag' -6 1 1 2YRE SER A 2 ? UNP Q8TB52 ? ? 'expression tag' -5 2 1 2YRE SER A 3 ? UNP Q8TB52 ? ? 'expression tag' -4 3 1 2YRE GLY A 4 ? UNP Q8TB52 ? ? 'expression tag' -3 4 1 2YRE SER A 5 ? UNP Q8TB52 ? ? 'expression tag' -2 5 1 2YRE SER A 6 ? UNP Q8TB52 ? ? 'expression tag' -1 6 1 2YRE GLY A 7 ? UNP Q8TB52 ? ? 'expression tag' 0 7 1 2YRE SER A 95 ? UNP Q8TB52 ? ? 'expression tag' 88 8 1 2YRE GLY A 96 ? UNP Q8TB52 ? ? 'expression tag' 89 9 1 2YRE PRO A 97 ? UNP Q8TB52 ? ? 'expression tag' 90 10 1 2YRE SER A 98 ? UNP Q8TB52 ? ? 'expression tag' 91 11 1 2YRE SER A 99 ? UNP Q8TB52 ? ? 'expression tag' 92 12 1 2YRE GLY A 100 ? UNP Q8TB52 ? ? 'expression tag' 93 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.29mM uniformly 13C, 15N-labeled protein; 20mM TrisHCl, 100mM NaCl, 1mM DTT, 0.02% NaN3, 0.05mM ZnCl2, 1mM IDA, 10% D2O, 90% H2O' _pdbx_nmr_sample_details.solvent_system '10% D2O, 90% H2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2YRE _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2YRE _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2YRE _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20020425 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9822 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2YRE _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2YRE _struct.title 'Solution structure of the zinc finger domains (1-87) from human F-box only protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YRE _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;zinc binding, E3 ubiquitin ligase, SCF, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 16 ? CYS A 20 ? HIS A 9 CYS A 13 5 ? 5 HELX_P HELX_P2 2 SER A 50 ? CYS A 60 ? SER A 43 CYS A 53 1 ? 11 HELX_P HELX_P3 3 LYS A 82 ? MET A 89 ? LYS A 75 MET A 82 1 ? 8 HELX_P HELX_P4 4 CYS A 90 ? VAL A 94 ? CYS A 83 VAL A 87 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 14 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 7 A ZN 401 1_555 ? ? ? ? ? ? ? 2.054 ? ? metalc2 metalc ? ? A HIS 16 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 9 A ZN 501 1_555 ? ? ? ? ? ? ? 2.052 ? ? metalc3 metalc ? ? A CYS 17 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 10 A ZN 401 1_555 ? ? ? ? ? ? ? 2.247 ? ? metalc4 metalc ? ? A CYS 20 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 13 A ZN 501 1_555 ? ? ? ? ? ? ? 2.303 ? ? metalc5 metalc ? ? A CYS 25 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 18 A ZN 501 1_555 ? ? ? ? ? ? ? 2.347 ? ? metalc6 metalc ? ? A CYS 35 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 401 1_555 ? ? ? ? ? ? ? 2.246 ? ? metalc7 metalc ? ? A CYS 40 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 33 A ZN 601 1_555 ? ? ? ? ? ? ? 2.260 ? ? metalc8 metalc ? ? A CYS 44 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 37 A ZN 601 1_555 ? ? ? ? ? ? ? 2.349 ? ? metalc9 metalc ? ? A HIS 49 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 42 A ZN 501 1_555 ? ? ? ? ? ? ? 2.057 ? ? metalc10 metalc ? ? A CYS 51 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 44 A ZN 401 1_555 ? ? ? ? ? ? ? 2.314 ? ? metalc11 metalc ? ? A HIS 56 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 49 A ZN 601 1_555 ? ? ? ? ? ? ? 2.042 ? ? metalc12 metalc ? ? A CYS 60 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 53 A ZN 601 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc13 metalc ? ? A CYS 67 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 60 A ZN 701 1_555 ? ? ? ? ? ? ? 2.283 ? ? metalc14 metalc ? ? A CYS 74 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 67 A ZN 701 1_555 ? ? ? ? ? ? ? 2.250 ? ? metalc15 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 79 A ZN 701 1_555 ? ? ? ? ? ? ? 2.049 ? ? metalc16 metalc ? ? A CYS 90 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 83 A ZN 701 1_555 ? ? ? ? ? ? ? 2.295 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 37 ? GLY A 39 ? LEU A 30 GLY A 32 A 2 VAL A 47 ? HIS A 49 ? VAL A 40 HIS A 42 B 1 ARG A 64 ? PRO A 66 ? ARG A 57 PRO A 59 B 2 THR A 77 ? ALA A 79 ? THR A 70 ALA A 72 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 38 ? N ILE A 31 O PHE A 48 ? O PHE A 41 B 1 2 N VAL A 65 ? N VAL A 58 O MET A 78 ? O MET A 71 # _database_PDB_matrix.entry_id 2YRE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2YRE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -6 -6 GLY GLY A . n A 1 2 SER 2 -5 -5 SER SER A . n A 1 3 SER 3 -4 -4 SER SER A . n A 1 4 GLY 4 -3 -3 GLY GLY A . n A 1 5 SER 5 -2 -2 SER SER A . n A 1 6 SER 6 -1 -1 SER SER A . n A 1 7 GLY 7 0 0 GLY GLY A . n A 1 8 MET 8 1 1 MET MET A . n A 1 9 GLU 9 2 2 GLU GLU A . n A 1 10 GLU 10 3 3 GLU GLU A . n A 1 11 GLU 11 4 4 GLU GLU A . n A 1 12 LEU 12 5 5 LEU LEU A . n A 1 13 GLN 13 6 6 GLN GLN A . n A 1 14 HIS 14 7 7 HIS HIS A . n A 1 15 SER 15 8 8 SER SER A . n A 1 16 HIS 16 9 9 HIS HIS A . n A 1 17 CYS 17 10 10 CYS CYS A . n A 1 18 VAL 18 11 11 VAL VAL A . n A 1 19 ASN 19 12 12 ASN ASN A . n A 1 20 CYS 20 13 13 CYS CYS A . n A 1 21 VAL 21 14 14 VAL VAL A . n A 1 22 SER 22 15 15 SER SER A . n A 1 23 ARG 23 16 16 ARG ARG A . n A 1 24 ARG 24 17 17 ARG ARG A . n A 1 25 CYS 25 18 18 CYS CYS A . n A 1 26 MET 26 19 19 MET MET A . n A 1 27 THR 27 20 20 THR THR A . n A 1 28 ARG 28 21 21 ARG ARG A . n A 1 29 PRO 29 22 22 PRO PRO A . n A 1 30 GLU 30 23 23 GLU GLU A . n A 1 31 PRO 31 24 24 PRO PRO A . n A 1 32 GLY 32 25 25 GLY GLY A . n A 1 33 ILE 33 26 26 ILE ILE A . n A 1 34 SER 34 27 27 SER SER A . n A 1 35 CYS 35 28 28 CYS CYS A . n A 1 36 ASP 36 29 29 ASP ASP A . n A 1 37 LEU 37 30 30 LEU LEU A . n A 1 38 ILE 38 31 31 ILE ILE A . n A 1 39 GLY 39 32 32 GLY GLY A . n A 1 40 CYS 40 33 33 CYS CYS A . n A 1 41 PRO 41 34 34 PRO PRO A . n A 1 42 LEU 42 35 35 LEU LEU A . n A 1 43 VAL 43 36 36 VAL VAL A . n A 1 44 CYS 44 37 37 CYS CYS A . n A 1 45 GLY 45 38 38 GLY GLY A . n A 1 46 ALA 46 39 39 ALA ALA A . n A 1 47 VAL 47 40 40 VAL VAL A . n A 1 48 PHE 48 41 41 PHE PHE A . n A 1 49 HIS 49 42 42 HIS HIS A . n A 1 50 SER 50 43 43 SER SER A . n A 1 51 CYS 51 44 44 CYS CYS A . n A 1 52 LYS 52 45 45 LYS LYS A . n A 1 53 ALA 53 46 46 ALA ALA A . n A 1 54 ASP 54 47 47 ASP ASP A . n A 1 55 GLU 55 48 48 GLU GLU A . n A 1 56 HIS 56 49 49 HIS HIS A . n A 1 57 ARG 57 50 50 ARG ARG A . n A 1 58 LEU 58 51 51 LEU LEU A . n A 1 59 LEU 59 52 52 LEU LEU A . n A 1 60 CYS 60 53 53 CYS CYS A . n A 1 61 PRO 61 54 54 PRO PRO A . n A 1 62 PHE 62 55 55 PHE PHE A . n A 1 63 GLU 63 56 56 GLU GLU A . n A 1 64 ARG 64 57 57 ARG ARG A . n A 1 65 VAL 65 58 58 VAL VAL A . n A 1 66 PRO 66 59 59 PRO PRO A . n A 1 67 CYS 67 60 60 CYS CYS A . n A 1 68 LEU 68 61 61 LEU LEU A . n A 1 69 ASN 69 62 62 ASN ASN A . n A 1 70 SER 70 63 63 SER SER A . n A 1 71 ASP 71 64 64 ASP ASP A . n A 1 72 PHE 72 65 65 PHE PHE A . n A 1 73 GLY 73 66 66 GLY GLY A . n A 1 74 CYS 74 67 67 CYS CYS A . n A 1 75 PRO 75 68 68 PRO PRO A . n A 1 76 PHE 76 69 69 PHE PHE A . n A 1 77 THR 77 70 70 THR THR A . n A 1 78 MET 78 71 71 MET MET A . n A 1 79 ALA 79 72 72 ALA ALA A . n A 1 80 ARG 80 73 73 ARG ARG A . n A 1 81 ASN 81 74 74 ASN ASN A . n A 1 82 LYS 82 75 75 LYS LYS A . n A 1 83 VAL 83 76 76 VAL VAL A . n A 1 84 ALA 84 77 77 ALA ALA A . n A 1 85 GLU 85 78 78 GLU GLU A . n A 1 86 HIS 86 79 79 HIS HIS A . n A 1 87 LEU 87 80 80 LEU LEU A . n A 1 88 GLU 88 81 81 GLU GLU A . n A 1 89 MET 89 82 82 MET MET A . n A 1 90 CYS 90 83 83 CYS CYS A . n A 1 91 PRO 91 84 84 PRO PRO A . n A 1 92 ALA 92 85 85 ALA ALA A . n A 1 93 SER 93 86 86 SER SER A . n A 1 94 VAL 94 87 87 VAL VAL A . n A 1 95 SER 95 88 88 SER SER A . n A 1 96 GLY 96 89 89 GLY GLY A . n A 1 97 PRO 97 90 90 PRO PRO A . n A 1 98 SER 98 91 91 SER SER A . n A 1 99 SER 99 92 92 SER SER A . n A 1 100 GLY 100 93 93 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 401 401 ZN ZN A . C 2 ZN 1 501 501 ZN ZN A . D 2 ZN 1 601 601 ZN ZN A . E 2 ZN 1 701 701 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 14 ? A HIS 7 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 17 ? A CYS 10 ? 1_555 108.6 ? 2 ND1 ? A HIS 14 ? A HIS 7 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 35 ? A CYS 28 ? 1_555 108.9 ? 3 SG ? A CYS 17 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 35 ? A CYS 28 ? 1_555 110.7 ? 4 ND1 ? A HIS 14 ? A HIS 7 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 51 ? A CYS 44 ? 1_555 106.5 ? 5 SG ? A CYS 17 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 51 ? A CYS 44 ? 1_555 106.7 ? 6 SG ? A CYS 35 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 51 ? A CYS 44 ? 1_555 115.3 ? 7 NE2 ? A HIS 16 ? A HIS 9 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 SG ? A CYS 20 ? A CYS 13 ? 1_555 109.1 ? 8 NE2 ? A HIS 16 ? A HIS 9 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 SG ? A CYS 25 ? A CYS 18 ? 1_555 105.1 ? 9 SG ? A CYS 20 ? A CYS 13 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 SG ? A CYS 25 ? A CYS 18 ? 1_555 103.6 ? 10 NE2 ? A HIS 16 ? A HIS 9 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 49 ? A HIS 42 ? 1_555 108.0 ? 11 SG ? A CYS 20 ? A CYS 13 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 49 ? A HIS 42 ? 1_555 116.2 ? 12 SG ? A CYS 25 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 49 ? A HIS 42 ? 1_555 114.3 ? 13 SG ? A CYS 40 ? A CYS 33 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 SG ? A CYS 44 ? A CYS 37 ? 1_555 104.8 ? 14 SG ? A CYS 40 ? A CYS 33 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 NE2 ? A HIS 56 ? A HIS 49 ? 1_555 116.2 ? 15 SG ? A CYS 44 ? A CYS 37 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 NE2 ? A HIS 56 ? A HIS 49 ? 1_555 114.2 ? 16 SG ? A CYS 40 ? A CYS 33 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 SG ? A CYS 60 ? A CYS 53 ? 1_555 106.9 ? 17 SG ? A CYS 44 ? A CYS 37 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 SG ? A CYS 60 ? A CYS 53 ? 1_555 101.9 ? 18 NE2 ? A HIS 56 ? A HIS 49 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 SG ? A CYS 60 ? A CYS 53 ? 1_555 111.5 ? 19 SG ? A CYS 67 ? A CYS 60 ? 1_555 ZN ? E ZN . ? A ZN 701 ? 1_555 SG ? A CYS 74 ? A CYS 67 ? 1_555 116.7 ? 20 SG ? A CYS 67 ? A CYS 60 ? 1_555 ZN ? E ZN . ? A ZN 701 ? 1_555 NE2 ? A HIS 86 ? A HIS 79 ? 1_555 107.7 ? 21 SG ? A CYS 74 ? A CYS 67 ? 1_555 ZN ? E ZN . ? A ZN 701 ? 1_555 NE2 ? A HIS 86 ? A HIS 79 ? 1_555 109.0 ? 22 SG ? A CYS 67 ? A CYS 60 ? 1_555 ZN ? E ZN . ? A ZN 701 ? 1_555 SG ? A CYS 90 ? A CYS 83 ? 1_555 107.2 ? 23 SG ? A CYS 74 ? A CYS 67 ? 1_555 ZN ? E ZN . ? A ZN 701 ? 1_555 SG ? A CYS 90 ? A CYS 83 ? 1_555 108.5 ? 24 NE2 ? A HIS 86 ? A HIS 79 ? 1_555 ZN ? E ZN . ? A ZN 701 ? 1_555 SG ? A CYS 90 ? A CYS 83 ? 1_555 107.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A -4 ? ? -171.31 148.58 2 1 ARG A 17 ? ? -86.44 32.49 3 1 PRO A 24 ? ? -69.73 88.52 4 1 CYS A 53 ? ? -33.06 126.30 5 1 GLU A 56 ? ? -34.16 128.96 6 1 LEU A 61 ? ? -39.76 -36.92 7 1 ASN A 62 ? ? -94.18 42.43 8 1 GLU A 78 ? ? -36.29 -35.91 9 1 ALA A 85 ? ? -82.52 40.36 10 1 VAL A 87 ? ? 35.62 41.28 11 1 PRO A 90 ? ? -69.75 3.45 12 1 SER A 91 ? ? -33.10 114.10 13 2 MET A 1 ? ? -170.21 124.11 14 2 LEU A 5 ? ? -65.20 -177.93 15 2 VAL A 14 ? ? -94.99 31.08 16 2 PRO A 24 ? ? -69.69 8.13 17 2 ILE A 26 ? ? -49.12 -75.29 18 2 PRO A 34 ? ? -69.75 0.02 19 2 CYS A 53 ? ? -32.86 132.84 20 2 GLU A 56 ? ? -37.00 135.49 21 2 ASN A 62 ? ? -80.68 44.41 22 2 PRO A 68 ? ? -69.74 1.84 23 2 VAL A 87 ? ? 33.09 42.38 24 2 PRO A 90 ? ? -69.78 99.89 25 3 ARG A 17 ? ? -83.75 32.01 26 3 PRO A 24 ? ? -69.79 8.13 27 3 ILE A 26 ? ? -48.33 -71.98 28 3 SER A 43 ? ? -34.95 -34.55 29 3 ASP A 47 ? ? -33.53 -37.43 30 3 CYS A 53 ? ? -32.19 129.28 31 3 ASN A 62 ? ? -88.64 46.19 32 3 VAL A 87 ? ? 31.80 47.29 33 3 PRO A 90 ? ? -69.82 90.43 34 4 SER A -5 ? ? -167.66 118.38 35 4 SER A -4 ? ? -172.02 118.62 36 4 ARG A 17 ? ? -82.77 36.47 37 4 PRO A 24 ? ? -69.70 10.20 38 4 ILE A 26 ? ? -54.33 -75.42 39 4 CYS A 53 ? ? -34.01 127.69 40 4 GLU A 56 ? ? -35.03 133.00 41 4 CYS A 60 ? ? -39.90 137.46 42 4 ASN A 62 ? ? -93.39 39.75 43 4 PHE A 69 ? ? -45.90 150.21 44 4 VAL A 87 ? ? 31.58 44.93 45 5 SER A 15 ? ? -48.87 150.01 46 5 ARG A 17 ? ? -85.83 38.24 47 5 MET A 19 ? ? -100.77 40.03 48 5 PRO A 24 ? ? -69.72 85.14 49 5 CYS A 33 ? ? -39.46 134.48 50 5 PRO A 34 ? ? -69.77 3.12 51 5 CYS A 53 ? ? -32.76 131.65 52 5 GLU A 56 ? ? -38.13 131.70 53 5 ASN A 62 ? ? -94.21 44.92 54 5 PRO A 68 ? ? -69.77 3.64 55 5 VAL A 87 ? ? 34.09 39.77 56 5 PRO A 90 ? ? -69.77 94.50 57 6 ARG A 17 ? ? -82.23 39.67 58 6 PRO A 24 ? ? -69.77 5.70 59 6 ILE A 26 ? ? -48.96 -75.96 60 6 CYS A 33 ? ? -38.78 133.89 61 6 CYS A 53 ? ? -29.65 129.89 62 6 ASN A 62 ? ? -87.13 39.65 63 6 VAL A 87 ? ? 33.29 47.55 64 7 MET A 19 ? ? -115.79 59.58 65 7 PRO A 24 ? ? -69.74 5.58 66 7 CYS A 33 ? ? -39.67 133.70 67 7 PRO A 34 ? ? -69.82 0.15 68 7 CYS A 53 ? ? -32.65 130.09 69 7 ASN A 62 ? ? -86.78 44.55 70 7 SER A 86 ? ? -83.08 37.30 71 7 VAL A 87 ? ? 34.28 40.83 72 7 SER A 92 ? ? -89.08 41.13 73 8 ARG A 17 ? ? -79.66 43.48 74 8 MET A 19 ? ? -109.65 41.39 75 8 PRO A 24 ? ? -69.74 14.40 76 8 CYS A 53 ? ? -33.76 129.54 77 8 GLU A 56 ? ? -34.53 140.80 78 8 ASN A 62 ? ? -88.69 42.92 79 8 VAL A 87 ? ? 29.58 49.47 80 8 SER A 92 ? ? -36.14 123.39 81 9 GLN A 6 ? ? -62.21 -175.23 82 9 ARG A 17 ? ? -82.10 41.11 83 9 MET A 19 ? ? -106.44 45.88 84 9 PRO A 24 ? ? -69.72 7.80 85 9 ALA A 46 ? ? -37.58 -34.09 86 9 ARG A 50 ? ? -38.66 -35.76 87 9 CYS A 53 ? ? -31.56 126.43 88 9 GLU A 56 ? ? -37.44 140.67 89 9 CYS A 60 ? ? -35.94 134.17 90 9 ASN A 62 ? ? -95.96 43.41 91 9 VAL A 87 ? ? 33.58 38.95 92 9 PRO A 90 ? ? -69.81 93.27 93 10 VAL A 11 ? ? -47.97 -19.60 94 10 SER A 15 ? ? -46.09 161.04 95 10 ARG A 17 ? ? -80.75 42.00 96 10 PRO A 24 ? ? -69.74 11.15 97 10 ILE A 26 ? ? -53.49 -73.71 98 10 CYS A 33 ? ? -35.91 134.16 99 10 SER A 43 ? ? -36.62 -39.83 100 10 ASP A 47 ? ? -37.39 -34.50 101 10 CYS A 53 ? ? -32.83 130.32 102 10 ASN A 62 ? ? -83.54 38.06 103 10 SER A 86 ? ? -84.04 40.91 104 10 PRO A 90 ? ? -69.79 2.97 105 10 SER A 91 ? ? -32.68 124.19 106 11 VAL A 14 ? ? -131.46 -32.40 107 11 ARG A 17 ? ? -88.46 41.27 108 11 MET A 19 ? ? -96.32 45.98 109 11 PRO A 24 ? ? -69.78 88.95 110 11 CYS A 53 ? ? -33.07 116.33 111 11 PRO A 54 ? ? -69.77 0.08 112 11 GLU A 56 ? ? -34.91 146.08 113 11 ASN A 62 ? ? -82.88 40.18 114 11 SER A 86 ? ? -83.68 37.38 115 11 VAL A 87 ? ? 36.61 39.06 116 11 PRO A 90 ? ? -69.74 99.71 117 12 ARG A 17 ? ? -91.33 32.18 118 12 CYS A 18 ? ? -39.08 104.91 119 12 MET A 19 ? ? -91.95 44.69 120 12 PRO A 24 ? ? -69.76 12.32 121 12 ILE A 26 ? ? -59.77 -77.93 122 12 CYS A 33 ? ? -38.76 133.92 123 12 PRO A 34 ? ? -69.75 2.54 124 12 CYS A 53 ? ? -30.81 130.11 125 12 ASN A 62 ? ? -94.58 33.68 126 12 VAL A 87 ? ? 35.11 35.02 127 13 SER A -4 ? ? 35.53 42.44 128 13 GLU A 3 ? ? -173.78 145.59 129 13 ARG A 17 ? ? -89.76 36.41 130 13 PRO A 24 ? ? -69.76 79.21 131 13 ILE A 26 ? ? -80.40 -75.07 132 13 CYS A 53 ? ? -33.87 129.91 133 13 ASN A 62 ? ? -84.17 49.59 134 13 SER A 86 ? ? -87.64 40.29 135 13 SER A 88 ? ? 39.83 43.24 136 13 PRO A 90 ? ? -69.76 93.33 137 14 GLN A 6 ? ? -57.27 171.36 138 14 PRO A 24 ? ? -69.72 78.66 139 14 ILE A 26 ? ? -83.28 -71.18 140 14 CYS A 33 ? ? -39.84 133.83 141 14 CYS A 53 ? ? -33.73 123.98 142 14 ASN A 62 ? ? -93.65 40.43 143 14 ARG A 73 ? ? -39.46 -33.96 144 14 VAL A 87 ? ? 28.13 50.67 145 15 LEU A 5 ? ? -69.64 -177.72 146 15 ARG A 17 ? ? -81.19 40.40 147 15 PRO A 24 ? ? -69.85 10.25 148 15 SER A 43 ? ? -38.25 -39.67 149 15 CYS A 53 ? ? -32.54 131.32 150 15 GLU A 56 ? ? -38.13 139.70 151 15 ASN A 62 ? ? -91.19 42.04 152 15 PRO A 68 ? ? -69.76 2.63 153 15 VAL A 87 ? ? 32.06 44.68 154 15 SER A 88 ? ? -131.72 -50.69 155 16 SER A -5 ? ? -173.54 134.95 156 16 SER A -1 ? ? -171.15 141.09 157 16 HIS A 9 ? ? -77.80 -70.73 158 16 ARG A 17 ? ? -94.83 32.93 159 16 PRO A 24 ? ? -69.81 10.10 160 16 ILE A 26 ? ? -54.35 -77.10 161 16 PRO A 34 ? ? -69.79 0.66 162 16 CYS A 53 ? ? -32.59 131.42 163 16 GLU A 56 ? ? -38.51 135.37 164 16 ASN A 62 ? ? -88.19 35.21 165 16 GLU A 78 ? ? -38.66 -29.71 166 16 VAL A 87 ? ? 31.69 47.07 167 17 GLU A 3 ? ? -174.03 148.44 168 17 GLN A 6 ? ? -59.69 174.00 169 17 ARG A 17 ? ? -85.89 43.33 170 17 MET A 19 ? ? -103.44 43.62 171 17 ARG A 21 ? ? -37.59 117.72 172 17 PRO A 24 ? ? -69.76 88.36 173 17 ASP A 47 ? ? -34.12 -34.79 174 17 CYS A 53 ? ? -31.02 128.17 175 17 GLU A 56 ? ? -39.01 135.39 176 17 ASN A 62 ? ? -82.64 44.05 177 17 VAL A 87 ? ? 29.76 49.02 178 18 VAL A 14 ? ? -99.46 31.43 179 18 ARG A 17 ? ? -81.94 40.05 180 18 PRO A 24 ? ? -69.77 5.66 181 18 SER A 43 ? ? -37.66 -37.86 182 18 CYS A 53 ? ? -32.45 118.68 183 18 GLU A 56 ? ? -33.46 138.63 184 18 CYS A 60 ? ? -35.56 137.91 185 18 ASN A 62 ? ? -93.35 40.56 186 18 PRO A 68 ? ? -69.72 2.48 187 18 VAL A 87 ? ? 35.92 44.94 188 19 ARG A 17 ? ? -83.97 32.11 189 19 PRO A 24 ? ? -69.81 6.95 190 19 CYS A 53 ? ? -32.94 119.94 191 19 ASN A 62 ? ? -85.11 43.14 192 19 SER A 86 ? ? -92.48 41.45 193 19 PRO A 90 ? ? -69.71 0.84 194 19 SER A 91 ? ? -49.34 94.92 195 19 SER A 92 ? ? -171.60 142.39 196 20 SER A -1 ? ? -171.15 132.57 197 20 ARG A 17 ? ? -81.02 41.78 198 20 PRO A 24 ? ? -69.76 8.16 199 20 ILE A 26 ? ? -48.78 -70.37 200 20 CYS A 53 ? ? -33.63 131.70 201 20 GLU A 56 ? ? -38.79 138.70 202 20 CYS A 60 ? ? -39.41 136.59 203 20 ASN A 62 ? ? -94.47 33.22 204 20 SER A 86 ? ? -82.94 37.54 205 20 SER A 91 ? ? -52.93 91.30 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #