data_2YRJ # _entry.id 2YRJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YRJ pdb_00002yrj 10.2210/pdb2yrj/pdb RCSB RCSB027043 ? ? WWPDB D_1000027043 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.entry_id 2YRJ _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-04-02 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2YRH 'The same protein' unspecified TargetDB hso003003493.2 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Izumi, K.' 2 'Yoshida, M.' 3 'Hayashi, F.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the C2H2-type zinc finger domain (781-813) from zinc finger protein 473' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Izumi, K.' 2 ? primary 'Yoshida, M.' 3 ? primary 'Hayashi, F.' 4 ? primary 'Yokoyama, S.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 473' 4685.094 1 ? ? 'C2H2-type zinc finger' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zinc finger protein 100 homolog, Zfp-100' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGTGEKPYRCGECGKAFAQKANLTQHQRIHTGEKPSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGTGEKPYRCGECGKAFAQKANLTQHQRIHTGEKPSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso003003493.2 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 THR n 1 9 GLY n 1 10 GLU n 1 11 LYS n 1 12 PRO n 1 13 TYR n 1 14 ARG n 1 15 CYS n 1 16 GLY n 1 17 GLU n 1 18 CYS n 1 19 GLY n 1 20 LYS n 1 21 ALA n 1 22 PHE n 1 23 ALA n 1 24 GLN n 1 25 LYS n 1 26 ALA n 1 27 ASN n 1 28 LEU n 1 29 THR n 1 30 GLN n 1 31 HIS n 1 32 GLN n 1 33 ARG n 1 34 ILE n 1 35 HIS n 1 36 THR n 1 37 GLY n 1 38 GLU n 1 39 LYS n 1 40 PRO n 1 41 SER n 1 42 GLY n 1 43 PRO n 1 44 SER n 1 45 SER n 1 46 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ZNF473 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P070115-35 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLY 46 46 46 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 200 _pdbx_nonpoly_scheme.auth_seq_num 200 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2YRJ _exptl.crystals_number ? # _struct.entry_id 2YRJ _struct.title 'Solution structure of the C2H2-type zinc finger domain (781-813) from zinc finger protein 473' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YRJ _struct_keywords.text ;C2H2-type zinc finger, Zinc finger protein 473, Zinc finger protein 100 homolog Zfp-100, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL CYCLE ; _struct_keywords.pdbx_keywords 'CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZN473_HUMAN _struct_ref.pdbx_db_accession Q8WTR7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TGEKPYRCGECGKAFAQKANLTQHQRIHTGEKP _struct_ref.pdbx_align_begin 781 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YRJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8WTR7 _struct_ref_seq.db_align_beg 781 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 813 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 40 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YRJ GLY A 1 ? UNP Q8WTR7 ? ? 'expression tag' 1 1 1 2YRJ SER A 2 ? UNP Q8WTR7 ? ? 'expression tag' 2 2 1 2YRJ SER A 3 ? UNP Q8WTR7 ? ? 'expression tag' 3 3 1 2YRJ GLY A 4 ? UNP Q8WTR7 ? ? 'expression tag' 4 4 1 2YRJ SER A 5 ? UNP Q8WTR7 ? ? 'expression tag' 5 5 1 2YRJ SER A 6 ? UNP Q8WTR7 ? ? 'expression tag' 6 6 1 2YRJ GLY A 7 ? UNP Q8WTR7 ? ? 'expression tag' 7 7 1 2YRJ SER A 41 ? UNP Q8WTR7 ? ? 'expression tag' 41 8 1 2YRJ GLY A 42 ? UNP Q8WTR7 ? ? 'expression tag' 42 9 1 2YRJ PRO A 43 ? UNP Q8WTR7 ? ? 'expression tag' 43 10 1 2YRJ SER A 44 ? UNP Q8WTR7 ? ? 'expression tag' 44 11 1 2YRJ SER A 45 ? UNP Q8WTR7 ? ? 'expression tag' 45 12 1 2YRJ GLY A 46 ? UNP Q8WTR7 ? ? 'expression tag' 46 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 24 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 33 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 24 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 33 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 15 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 15 A ZN 200 1_555 ? ? ? ? ? ? ? 2.351 ? ? metalc2 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 200 1_555 ? ? ? ? ? ? ? 2.248 ? ? metalc3 metalc ? ? A HIS 31 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 31 A ZN 200 1_555 ? ? ? ? ? ? ? 2.055 ? ? metalc4 metalc ? ? A HIS 35 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 35 A ZN 200 1_555 ? ? ? ? ? ? ? 2.052 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 15 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 18 ? A CYS 18 ? 1_555 105.0 ? 2 SG ? A CYS 15 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 104.9 ? 3 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 108.7 ? 4 SG ? A CYS 15 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 114.0 ? 5 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 117.2 ? 6 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 106.4 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 13 ? ARG A 14 ? TYR A 13 ARG A 14 A 2 ALA A 21 ? PHE A 22 ? ALA A 21 PHE A 22 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 13 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 13 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 22 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 22 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 10 ? ? -53.30 170.89 2 1 CYS A 15 ? ? -48.30 153.33 3 1 LYS A 20 ? ? -60.87 -174.99 4 1 THR A 36 ? ? -56.13 94.55 5 1 PRO A 43 ? ? -69.77 96.61 6 1 SER A 45 ? ? 38.12 42.24 7 2 PRO A 40 ? ? -69.74 94.24 8 2 SER A 45 ? ? -91.90 41.86 9 3 CYS A 15 ? ? -49.54 153.19 10 3 LYS A 20 ? ? -61.65 -175.03 11 4 CYS A 15 ? ? -48.82 153.93 12 4 LYS A 20 ? ? -62.00 -176.44 13 4 PRO A 40 ? ? -69.73 80.81 14 5 SER A 3 ? ? -165.83 108.62 15 5 CYS A 15 ? ? -47.20 151.49 16 5 LYS A 20 ? ? -61.68 -174.94 17 5 THR A 36 ? ? -38.07 110.23 18 5 PRO A 40 ? ? -69.78 96.69 19 6 SER A 5 ? ? -90.82 42.62 20 6 SER A 6 ? ? -81.94 42.06 21 6 CYS A 15 ? ? -48.17 155.26 22 6 LYS A 20 ? ? -62.03 -176.57 23 6 PRO A 43 ? ? -69.75 93.85 24 7 CYS A 15 ? ? -49.07 152.38 25 7 LYS A 20 ? ? -62.33 -175.03 26 7 PRO A 40 ? ? -69.79 92.41 27 7 SER A 45 ? ? -82.79 48.68 28 8 SER A 2 ? ? -173.43 135.80 29 8 CYS A 15 ? ? -48.72 154.54 30 8 LYS A 20 ? ? -61.57 -174.82 31 8 THR A 36 ? ? -69.92 94.82 32 9 CYS A 15 ? ? -48.97 152.97 33 9 LYS A 20 ? ? -62.37 -177.82 34 11 SER A 6 ? ? -35.11 133.84 35 11 CYS A 15 ? ? -47.58 152.70 36 11 LYS A 20 ? ? -63.25 -174.94 37 11 GLU A 38 ? ? -56.88 106.93 38 12 SER A 5 ? ? -44.29 150.34 39 12 CYS A 15 ? ? -48.14 153.48 40 12 LYS A 20 ? ? -63.13 -174.52 41 12 HIS A 35 ? ? -89.17 30.78 42 13 THR A 8 ? ? 36.25 40.04 43 13 LYS A 20 ? ? -61.20 -174.83 44 13 SER A 44 ? ? -51.62 104.83 45 14 THR A 8 ? ? -130.35 -50.40 46 14 CYS A 15 ? ? -47.69 151.84 47 14 LYS A 20 ? ? -61.33 -174.89 48 14 PRO A 40 ? ? -69.77 1.51 49 14 SER A 41 ? ? -37.06 107.65 50 15 THR A 8 ? ? -50.75 99.33 51 15 CYS A 15 ? ? -47.66 150.71 52 15 LYS A 20 ? ? -61.96 -175.56 53 15 PRO A 40 ? ? -69.76 1.96 54 16 LYS A 20 ? ? -58.94 -175.10 55 17 CYS A 15 ? ? -49.14 152.54 56 17 LYS A 20 ? ? -59.92 -174.49 57 17 GLU A 38 ? ? -37.69 119.67 58 18 SER A 2 ? ? -59.87 104.75 59 18 SER A 5 ? ? -56.69 175.57 60 18 CYS A 15 ? ? -48.04 154.60 61 18 LYS A 20 ? ? -62.64 -174.94 62 18 SER A 41 ? ? -36.76 119.60 63 18 PRO A 43 ? ? -69.72 2.16 64 19 CYS A 15 ? ? -47.97 154.72 65 19 LYS A 20 ? ? -62.24 -176.04 66 19 SER A 45 ? ? -99.88 42.84 67 20 CYS A 15 ? ? -49.40 154.17 68 20 LYS A 20 ? ? -60.30 -179.08 69 20 THR A 36 ? ? -60.70 87.72 70 20 PRO A 40 ? ? -69.73 85.06 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.entry_id 2YRJ _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2YRJ # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.08mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZnCl2+1mM IDA, 90% H2O, 10%D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2YRJ _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection Delta 4.3 JEOL 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 HIS N N N N 121 HIS CA C N S 122 HIS C C N N 123 HIS O O N N 124 HIS CB C N N 125 HIS CG C Y N 126 HIS ND1 N Y N 127 HIS CD2 C Y N 128 HIS CE1 C Y N 129 HIS NE2 N Y N 130 HIS OXT O N N 131 HIS H H N N 132 HIS H2 H N N 133 HIS HA H N N 134 HIS HB2 H N N 135 HIS HB3 H N N 136 HIS HD1 H N N 137 HIS HD2 H N N 138 HIS HE1 H N N 139 HIS HE2 H N N 140 HIS HXT H N N 141 ILE N N N N 142 ILE CA C N S 143 ILE C C N N 144 ILE O O N N 145 ILE CB C N S 146 ILE CG1 C N N 147 ILE CG2 C N N 148 ILE CD1 C N N 149 ILE OXT O N N 150 ILE H H N N 151 ILE H2 H N N 152 ILE HA H N N 153 ILE HB H N N 154 ILE HG12 H N N 155 ILE HG13 H N N 156 ILE HG21 H N N 157 ILE HG22 H N N 158 ILE HG23 H N N 159 ILE HD11 H N N 160 ILE HD12 H N N 161 ILE HD13 H N N 162 ILE HXT H N N 163 LEU N N N N 164 LEU CA C N S 165 LEU C C N N 166 LEU O O N N 167 LEU CB C N N 168 LEU CG C N N 169 LEU CD1 C N N 170 LEU CD2 C N N 171 LEU OXT O N N 172 LEU H H N N 173 LEU H2 H N N 174 LEU HA H N N 175 LEU HB2 H N N 176 LEU HB3 H N N 177 LEU HG H N N 178 LEU HD11 H N N 179 LEU HD12 H N N 180 LEU HD13 H N N 181 LEU HD21 H N N 182 LEU HD22 H N N 183 LEU HD23 H N N 184 LEU HXT H N N 185 LYS N N N N 186 LYS CA C N S 187 LYS C C N N 188 LYS O O N N 189 LYS CB C N N 190 LYS CG C N N 191 LYS CD C N N 192 LYS CE C N N 193 LYS NZ N N N 194 LYS OXT O N N 195 LYS H H N N 196 LYS H2 H N N 197 LYS HA H N N 198 LYS HB2 H N N 199 LYS HB3 H N N 200 LYS HG2 H N N 201 LYS HG3 H N N 202 LYS HD2 H N N 203 LYS HD3 H N N 204 LYS HE2 H N N 205 LYS HE3 H N N 206 LYS HZ1 H N N 207 LYS HZ2 H N N 208 LYS HZ3 H N N 209 LYS HXT H N N 210 PHE N N N N 211 PHE CA C N S 212 PHE C C N N 213 PHE O O N N 214 PHE CB C N N 215 PHE CG C Y N 216 PHE CD1 C Y N 217 PHE CD2 C Y N 218 PHE CE1 C Y N 219 PHE CE2 C Y N 220 PHE CZ C Y N 221 PHE OXT O N N 222 PHE H H N N 223 PHE H2 H N N 224 PHE HA H N N 225 PHE HB2 H N N 226 PHE HB3 H N N 227 PHE HD1 H N N 228 PHE HD2 H N N 229 PHE HE1 H N N 230 PHE HE2 H N N 231 PHE HZ H N N 232 PHE HXT H N N 233 PRO N N N N 234 PRO CA C N S 235 PRO C C N N 236 PRO O O N N 237 PRO CB C N N 238 PRO CG C N N 239 PRO CD C N N 240 PRO OXT O N N 241 PRO H H N N 242 PRO HA H N N 243 PRO HB2 H N N 244 PRO HB3 H N N 245 PRO HG2 H N N 246 PRO HG3 H N N 247 PRO HD2 H N N 248 PRO HD3 H N N 249 PRO HXT H N N 250 SER N N N N 251 SER CA C N S 252 SER C C N N 253 SER O O N N 254 SER CB C N N 255 SER OG O N N 256 SER OXT O N N 257 SER H H N N 258 SER H2 H N N 259 SER HA H N N 260 SER HB2 H N N 261 SER HB3 H N N 262 SER HG H N N 263 SER HXT H N N 264 THR N N N N 265 THR CA C N S 266 THR C C N N 267 THR O O N N 268 THR CB C N R 269 THR OG1 O N N 270 THR CG2 C N N 271 THR OXT O N N 272 THR H H N N 273 THR H2 H N N 274 THR HA H N N 275 THR HB H N N 276 THR HG1 H N N 277 THR HG21 H N N 278 THR HG22 H N N 279 THR HG23 H N N 280 THR HXT H N N 281 TYR N N N N 282 TYR CA C N S 283 TYR C C N N 284 TYR O O N N 285 TYR CB C N N 286 TYR CG C Y N 287 TYR CD1 C Y N 288 TYR CD2 C Y N 289 TYR CE1 C Y N 290 TYR CE2 C Y N 291 TYR CZ C Y N 292 TYR OH O N N 293 TYR OXT O N N 294 TYR H H N N 295 TYR H2 H N N 296 TYR HA H N N 297 TYR HB2 H N N 298 TYR HB3 H N N 299 TYR HD1 H N N 300 TYR HD2 H N N 301 TYR HE1 H N N 302 TYR HE2 H N N 303 TYR HH H N N 304 TYR HXT H N N 305 ZN ZN ZN N N 306 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 HIS N CA sing N N 114 HIS N H sing N N 115 HIS N H2 sing N N 116 HIS CA C sing N N 117 HIS CA CB sing N N 118 HIS CA HA sing N N 119 HIS C O doub N N 120 HIS C OXT sing N N 121 HIS CB CG sing N N 122 HIS CB HB2 sing N N 123 HIS CB HB3 sing N N 124 HIS CG ND1 sing Y N 125 HIS CG CD2 doub Y N 126 HIS ND1 CE1 doub Y N 127 HIS ND1 HD1 sing N N 128 HIS CD2 NE2 sing Y N 129 HIS CD2 HD2 sing N N 130 HIS CE1 NE2 sing Y N 131 HIS CE1 HE1 sing N N 132 HIS NE2 HE2 sing N N 133 HIS OXT HXT sing N N 134 ILE N CA sing N N 135 ILE N H sing N N 136 ILE N H2 sing N N 137 ILE CA C sing N N 138 ILE CA CB sing N N 139 ILE CA HA sing N N 140 ILE C O doub N N 141 ILE C OXT sing N N 142 ILE CB CG1 sing N N 143 ILE CB CG2 sing N N 144 ILE CB HB sing N N 145 ILE CG1 CD1 sing N N 146 ILE CG1 HG12 sing N N 147 ILE CG1 HG13 sing N N 148 ILE CG2 HG21 sing N N 149 ILE CG2 HG22 sing N N 150 ILE CG2 HG23 sing N N 151 ILE CD1 HD11 sing N N 152 ILE CD1 HD12 sing N N 153 ILE CD1 HD13 sing N N 154 ILE OXT HXT sing N N 155 LEU N CA sing N N 156 LEU N H sing N N 157 LEU N H2 sing N N 158 LEU CA C sing N N 159 LEU CA CB sing N N 160 LEU CA HA sing N N 161 LEU C O doub N N 162 LEU C OXT sing N N 163 LEU CB CG sing N N 164 LEU CB HB2 sing N N 165 LEU CB HB3 sing N N 166 LEU CG CD1 sing N N 167 LEU CG CD2 sing N N 168 LEU CG HG sing N N 169 LEU CD1 HD11 sing N N 170 LEU CD1 HD12 sing N N 171 LEU CD1 HD13 sing N N 172 LEU CD2 HD21 sing N N 173 LEU CD2 HD22 sing N N 174 LEU CD2 HD23 sing N N 175 LEU OXT HXT sing N N 176 LYS N CA sing N N 177 LYS N H sing N N 178 LYS N H2 sing N N 179 LYS CA C sing N N 180 LYS CA CB sing N N 181 LYS CA HA sing N N 182 LYS C O doub N N 183 LYS C OXT sing N N 184 LYS CB CG sing N N 185 LYS CB HB2 sing N N 186 LYS CB HB3 sing N N 187 LYS CG CD sing N N 188 LYS CG HG2 sing N N 189 LYS CG HG3 sing N N 190 LYS CD CE sing N N 191 LYS CD HD2 sing N N 192 LYS CD HD3 sing N N 193 LYS CE NZ sing N N 194 LYS CE HE2 sing N N 195 LYS CE HE3 sing N N 196 LYS NZ HZ1 sing N N 197 LYS NZ HZ2 sing N N 198 LYS NZ HZ3 sing N N 199 LYS OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TYR N CA sing N N 270 TYR N H sing N N 271 TYR N H2 sing N N 272 TYR CA C sing N N 273 TYR CA CB sing N N 274 TYR CA HA sing N N 275 TYR C O doub N N 276 TYR C OXT sing N N 277 TYR CB CG sing N N 278 TYR CB HB2 sing N N 279 TYR CB HB3 sing N N 280 TYR CG CD1 doub Y N 281 TYR CG CD2 sing Y N 282 TYR CD1 CE1 sing Y N 283 TYR CD1 HD1 sing N N 284 TYR CD2 CE2 doub Y N 285 TYR CD2 HD2 sing N N 286 TYR CE1 CZ doub Y N 287 TYR CE1 HE1 sing N N 288 TYR CE2 CZ sing Y N 289 TYR CE2 HE2 sing N N 290 TYR CZ OH sing N N 291 TYR OH HH sing N N 292 TYR OXT HXT sing N N 293 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer JEOL _pdbx_nmr_spectrometer.model ECA _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2YRJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ #