data_2YSA # _entry.id 2YSA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YSA pdb_00002ysa 10.2210/pdb2ysa/pdb RCSB RCSB027070 ? ? WWPDB D_1000027070 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 2YSA _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-04-03 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso002000490.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohnishi, S.' 1 'Sato, M.' 2 'Tochio, N.' 3 'Koshiba, S.' 4 'Harada, T.' 5 'Watanabe, S.' 6 'Kigawa, T.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title ;Solution structure of the zinc finger CCHC domain from the human retinoblastoma-binding protein 6 (Retinoblastoma-binding Q protein 1, RBQ-1) ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohnishi, S.' 1 ? primary 'Sato, M.' 2 ? primary 'Tochio, N.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Harada, T.' 5 ? primary 'Watanabe, S.' 6 ? primary 'Kigawa, T.' 7 ? primary 'Yokoyama, S.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Retinoblastoma-binding protein 6' 5980.772 1 ? ? 'zf-CCHC domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;p53-associated cellular protein of testis, Proliferation potential-related protein, Protein P2P-R, Retinoblastoma-binding Q protein 1, Protein RBQ-1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGYTCFRCGKPGHYIKNCPTNGDKNFESGPRIKKSTGIPRSFMMEVKDPN _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGYTCFRCGKPGHYIKNCPTNGDKNFESGPRIKKSTGIPRSFMMEVKDPN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso002000490.2 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 TYR n 1 9 THR n 1 10 CYS n 1 11 PHE n 1 12 ARG n 1 13 CYS n 1 14 GLY n 1 15 LYS n 1 16 PRO n 1 17 GLY n 1 18 HIS n 1 19 TYR n 1 20 ILE n 1 21 LYS n 1 22 ASN n 1 23 CYS n 1 24 PRO n 1 25 THR n 1 26 ASN n 1 27 GLY n 1 28 ASP n 1 29 LYS n 1 30 ASN n 1 31 PHE n 1 32 GLU n 1 33 SER n 1 34 GLY n 1 35 PRO n 1 36 ARG n 1 37 ILE n 1 38 LYS n 1 39 LYS n 1 40 SER n 1 41 THR n 1 42 GLY n 1 43 ILE n 1 44 PRO n 1 45 ARG n 1 46 SER n 1 47 PHE n 1 48 MET n 1 49 MET n 1 50 GLU n 1 51 VAL n 1 52 LYS n 1 53 ASP n 1 54 PRO n 1 55 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene RBBP6 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060522-23 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ASN 55 55 55 ASN ASN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 181 _pdbx_nonpoly_scheme.auth_seq_num 181 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2YSA _exptl.crystals_number ? # _struct.entry_id 2YSA _struct.title ;Solution structure of the zinc finger CCHC domain from the human retinoblastoma-binding protein 6 (Retinoblastoma-binding Q protein 1, RBQ-1) ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YSA _struct_keywords.text ;zinc finger, CCHC, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RBBP6_HUMAN _struct_ref.pdbx_db_accession Q7Z6E9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code YTCFRCGKPGHYIKNCPTNGDKNFESGPRIKKSTGIPRSFMMEVKDPN _struct_ref.pdbx_align_begin 159 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YSA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 55 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7Z6E9 _struct_ref_seq.db_align_beg 159 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 206 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 55 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YSA GLY A 1 ? UNP Q7Z6E9 ? ? 'expression tag' 1 1 1 2YSA SER A 2 ? UNP Q7Z6E9 ? ? 'expression tag' 2 2 1 2YSA SER A 3 ? UNP Q7Z6E9 ? ? 'expression tag' 3 3 1 2YSA GLY A 4 ? UNP Q7Z6E9 ? ? 'expression tag' 4 4 1 2YSA SER A 5 ? UNP Q7Z6E9 ? ? 'expression tag' 5 5 1 2YSA SER A 6 ? UNP Q7Z6E9 ? ? 'expression tag' 6 6 1 2YSA GLY A 7 ? UNP Q7Z6E9 ? ? 'expression tag' 7 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 19 ? CYS A 23 ? TYR A 19 CYS A 23 5 ? 5 HELX_P HELX_P2 2 PRO A 24 ? ASP A 28 ? PRO A 24 ASP A 28 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 10 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 10 A ZN 181 1_555 ? ? ? ? ? ? ? 2.391 ? ? metalc2 metalc ? ? A CYS 13 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 13 A ZN 181 1_555 ? ? ? ? ? ? ? 2.292 ? ? metalc3 metalc ? ? A HIS 18 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 18 A ZN 181 1_555 ? ? ? ? ? ? ? 2.100 ? ? metalc4 metalc ? ? A CYS 23 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 23 A ZN 181 1_555 ? ? ? ? ? ? ? 2.301 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 10 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 181 ? 1_555 SG ? A CYS 13 ? A CYS 13 ? 1_555 114.6 ? 2 SG ? A CYS 10 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 181 ? 1_555 NE2 ? A HIS 18 ? A HIS 18 ? 1_555 96.2 ? 3 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 181 ? 1_555 NE2 ? A HIS 18 ? A HIS 18 ? 1_555 115.2 ? 4 SG ? A CYS 10 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 181 ? 1_555 SG ? A CYS 23 ? A CYS 23 ? 1_555 98.6 ? 5 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 181 ? 1_555 SG ? A CYS 23 ? A CYS 23 ? 1_555 119.2 ? 6 NE2 ? A HIS 18 ? A HIS 18 ? 1_555 ZN ? B ZN . ? A ZN 181 ? 1_555 SG ? A CYS 23 ? A CYS 23 ? 1_555 109.6 ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 181 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 181' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 10 ? CYS A 10 . ? 1_555 ? 2 AC1 4 CYS A 13 ? CYS A 13 . ? 1_555 ? 3 AC1 4 HIS A 18 ? HIS A 18 . ? 1_555 ? 4 AC1 4 CYS A 23 ? CYS A 23 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 16 ? ? -69.78 -179.12 2 2 TYR A 8 ? ? -53.26 176.35 3 2 PRO A 16 ? ? -69.74 -174.58 4 2 THR A 25 ? ? -34.13 -33.20 5 3 TYR A 8 ? ? -53.99 172.51 6 3 LYS A 29 ? ? -97.96 -62.86 7 3 PRO A 35 ? ? -69.83 2.79 8 3 PRO A 44 ? ? -69.76 80.17 9 3 PRO A 54 ? ? -69.79 2.82 10 4 CYS A 10 ? ? -52.04 109.84 11 4 PRO A 16 ? ? -69.72 -178.08 12 4 THR A 25 ? ? -35.57 -39.34 13 4 PRO A 35 ? ? -69.73 2.91 14 4 PRO A 44 ? ? -69.69 9.96 15 5 TYR A 8 ? ? -51.99 176.63 16 5 ASN A 26 ? ? -52.12 102.18 17 6 PRO A 16 ? ? -69.72 -177.22 18 6 THR A 25 ? ? -37.49 -33.35 19 6 PRO A 54 ? ? -69.78 2.69 20 7 PRO A 16 ? ? -69.73 -174.99 21 7 PRO A 44 ? ? -69.76 83.96 22 7 PHE A 47 ? ? -56.05 109.26 23 8 TYR A 8 ? ? -54.74 175.51 24 8 ASN A 30 ? ? -52.02 107.74 25 8 THR A 41 ? ? -39.38 -34.94 26 8 PRO A 54 ? ? -69.69 3.08 27 9 PRO A 16 ? ? -69.80 -178.41 28 9 THR A 25 ? ? -33.33 -39.52 29 9 GLU A 32 ? ? -97.07 -63.41 30 9 PRO A 44 ? ? -69.83 -171.28 31 9 ARG A 45 ? ? -33.78 -38.80 32 10 PRO A 16 ? ? -69.72 -176.31 33 10 THR A 25 ? ? -38.18 -33.94 34 11 PRO A 16 ? ? -69.83 -178.09 35 11 THR A 25 ? ? -34.66 -38.32 36 11 PRO A 54 ? ? -69.73 1.98 37 12 PRO A 44 ? ? -69.73 -164.13 38 12 ARG A 45 ? ? -39.55 -39.64 39 13 TYR A 8 ? ? -52.05 176.92 40 13 ARG A 12 ? ? -93.30 -64.83 41 13 PRO A 16 ? ? -69.73 -174.32 42 14 PRO A 16 ? ? -69.73 -178.85 43 14 THR A 25 ? ? -34.04 -36.85 44 15 LYS A 29 ? ? -53.08 177.16 45 15 PRO A 35 ? ? -69.79 2.85 46 15 PRO A 44 ? ? -69.76 -90.82 47 16 PRO A 16 ? ? -69.75 -177.40 48 16 ILE A 20 ? ? -59.21 -9.64 49 16 LYS A 29 ? ? -96.52 -65.56 50 16 PRO A 44 ? ? -69.72 5.00 51 16 PHE A 47 ? ? -55.10 176.66 52 17 SER A 3 ? ? -58.71 174.14 53 17 TYR A 8 ? ? -52.15 177.75 54 17 THR A 25 ? ? -37.87 -28.76 55 17 ASP A 28 ? ? -59.51 107.88 56 17 PRO A 35 ? ? -69.78 -178.58 57 18 PRO A 16 ? ? -69.73 -176.28 58 18 THR A 25 ? ? -38.17 -39.51 59 18 PRO A 35 ? ? -69.72 -174.78 60 18 PRO A 44 ? ? -69.80 -167.83 61 19 PRO A 16 ? ? -69.78 -177.64 62 19 THR A 25 ? ? -36.02 -36.25 63 19 ASN A 26 ? ? -53.59 108.23 64 19 PRO A 54 ? ? -69.72 3.60 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.entry_id 2YSA _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2YSA # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM sample U-15N,13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2YSA _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLU N N N N 75 GLU CA C N S 76 GLU C C N N 77 GLU O O N N 78 GLU CB C N N 79 GLU CG C N N 80 GLU CD C N N 81 GLU OE1 O N N 82 GLU OE2 O N N 83 GLU OXT O N N 84 GLU H H N N 85 GLU H2 H N N 86 GLU HA H N N 87 GLU HB2 H N N 88 GLU HB3 H N N 89 GLU HG2 H N N 90 GLU HG3 H N N 91 GLU HE2 H N N 92 GLU HXT H N N 93 GLY N N N N 94 GLY CA C N N 95 GLY C C N N 96 GLY O O N N 97 GLY OXT O N N 98 GLY H H N N 99 GLY H2 H N N 100 GLY HA2 H N N 101 GLY HA3 H N N 102 GLY HXT H N N 103 HIS N N N N 104 HIS CA C N S 105 HIS C C N N 106 HIS O O N N 107 HIS CB C N N 108 HIS CG C Y N 109 HIS ND1 N Y N 110 HIS CD2 C Y N 111 HIS CE1 C Y N 112 HIS NE2 N Y N 113 HIS OXT O N N 114 HIS H H N N 115 HIS H2 H N N 116 HIS HA H N N 117 HIS HB2 H N N 118 HIS HB3 H N N 119 HIS HD1 H N N 120 HIS HD2 H N N 121 HIS HE1 H N N 122 HIS HE2 H N N 123 HIS HXT H N N 124 ILE N N N N 125 ILE CA C N S 126 ILE C C N N 127 ILE O O N N 128 ILE CB C N S 129 ILE CG1 C N N 130 ILE CG2 C N N 131 ILE CD1 C N N 132 ILE OXT O N N 133 ILE H H N N 134 ILE H2 H N N 135 ILE HA H N N 136 ILE HB H N N 137 ILE HG12 H N N 138 ILE HG13 H N N 139 ILE HG21 H N N 140 ILE HG22 H N N 141 ILE HG23 H N N 142 ILE HD11 H N N 143 ILE HD12 H N N 144 ILE HD13 H N N 145 ILE HXT H N N 146 LYS N N N N 147 LYS CA C N S 148 LYS C C N N 149 LYS O O N N 150 LYS CB C N N 151 LYS CG C N N 152 LYS CD C N N 153 LYS CE C N N 154 LYS NZ N N N 155 LYS OXT O N N 156 LYS H H N N 157 LYS H2 H N N 158 LYS HA H N N 159 LYS HB2 H N N 160 LYS HB3 H N N 161 LYS HG2 H N N 162 LYS HG3 H N N 163 LYS HD2 H N N 164 LYS HD3 H N N 165 LYS HE2 H N N 166 LYS HE3 H N N 167 LYS HZ1 H N N 168 LYS HZ2 H N N 169 LYS HZ3 H N N 170 LYS HXT H N N 171 MET N N N N 172 MET CA C N S 173 MET C C N N 174 MET O O N N 175 MET CB C N N 176 MET CG C N N 177 MET SD S N N 178 MET CE C N N 179 MET OXT O N N 180 MET H H N N 181 MET H2 H N N 182 MET HA H N N 183 MET HB2 H N N 184 MET HB3 H N N 185 MET HG2 H N N 186 MET HG3 H N N 187 MET HE1 H N N 188 MET HE2 H N N 189 MET HE3 H N N 190 MET HXT H N N 191 PHE N N N N 192 PHE CA C N S 193 PHE C C N N 194 PHE O O N N 195 PHE CB C N N 196 PHE CG C Y N 197 PHE CD1 C Y N 198 PHE CD2 C Y N 199 PHE CE1 C Y N 200 PHE CE2 C Y N 201 PHE CZ C Y N 202 PHE OXT O N N 203 PHE H H N N 204 PHE H2 H N N 205 PHE HA H N N 206 PHE HB2 H N N 207 PHE HB3 H N N 208 PHE HD1 H N N 209 PHE HD2 H N N 210 PHE HE1 H N N 211 PHE HE2 H N N 212 PHE HZ H N N 213 PHE HXT H N N 214 PRO N N N N 215 PRO CA C N S 216 PRO C C N N 217 PRO O O N N 218 PRO CB C N N 219 PRO CG C N N 220 PRO CD C N N 221 PRO OXT O N N 222 PRO H H N N 223 PRO HA H N N 224 PRO HB2 H N N 225 PRO HB3 H N N 226 PRO HG2 H N N 227 PRO HG3 H N N 228 PRO HD2 H N N 229 PRO HD3 H N N 230 PRO HXT H N N 231 SER N N N N 232 SER CA C N S 233 SER C C N N 234 SER O O N N 235 SER CB C N N 236 SER OG O N N 237 SER OXT O N N 238 SER H H N N 239 SER H2 H N N 240 SER HA H N N 241 SER HB2 H N N 242 SER HB3 H N N 243 SER HG H N N 244 SER HXT H N N 245 THR N N N N 246 THR CA C N S 247 THR C C N N 248 THR O O N N 249 THR CB C N R 250 THR OG1 O N N 251 THR CG2 C N N 252 THR OXT O N N 253 THR H H N N 254 THR H2 H N N 255 THR HA H N N 256 THR HB H N N 257 THR HG1 H N N 258 THR HG21 H N N 259 THR HG22 H N N 260 THR HG23 H N N 261 THR HXT H N N 262 TYR N N N N 263 TYR CA C N S 264 TYR C C N N 265 TYR O O N N 266 TYR CB C N N 267 TYR CG C Y N 268 TYR CD1 C Y N 269 TYR CD2 C Y N 270 TYR CE1 C Y N 271 TYR CE2 C Y N 272 TYR CZ C Y N 273 TYR OH O N N 274 TYR OXT O N N 275 TYR H H N N 276 TYR H2 H N N 277 TYR HA H N N 278 TYR HB2 H N N 279 TYR HB3 H N N 280 TYR HD1 H N N 281 TYR HD2 H N N 282 TYR HE1 H N N 283 TYR HE2 H N N 284 TYR HH H N N 285 TYR HXT H N N 286 VAL N N N N 287 VAL CA C N S 288 VAL C C N N 289 VAL O O N N 290 VAL CB C N N 291 VAL CG1 C N N 292 VAL CG2 C N N 293 VAL OXT O N N 294 VAL H H N N 295 VAL H2 H N N 296 VAL HA H N N 297 VAL HB H N N 298 VAL HG11 H N N 299 VAL HG12 H N N 300 VAL HG13 H N N 301 VAL HG21 H N N 302 VAL HG22 H N N 303 VAL HG23 H N N 304 VAL HXT H N N 305 ZN ZN ZN N N 306 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLU N CA sing N N 71 GLU N H sing N N 72 GLU N H2 sing N N 73 GLU CA C sing N N 74 GLU CA CB sing N N 75 GLU CA HA sing N N 76 GLU C O doub N N 77 GLU C OXT sing N N 78 GLU CB CG sing N N 79 GLU CB HB2 sing N N 80 GLU CB HB3 sing N N 81 GLU CG CD sing N N 82 GLU CG HG2 sing N N 83 GLU CG HG3 sing N N 84 GLU CD OE1 doub N N 85 GLU CD OE2 sing N N 86 GLU OE2 HE2 sing N N 87 GLU OXT HXT sing N N 88 GLY N CA sing N N 89 GLY N H sing N N 90 GLY N H2 sing N N 91 GLY CA C sing N N 92 GLY CA HA2 sing N N 93 GLY CA HA3 sing N N 94 GLY C O doub N N 95 GLY C OXT sing N N 96 GLY OXT HXT sing N N 97 HIS N CA sing N N 98 HIS N H sing N N 99 HIS N H2 sing N N 100 HIS CA C sing N N 101 HIS CA CB sing N N 102 HIS CA HA sing N N 103 HIS C O doub N N 104 HIS C OXT sing N N 105 HIS CB CG sing N N 106 HIS CB HB2 sing N N 107 HIS CB HB3 sing N N 108 HIS CG ND1 sing Y N 109 HIS CG CD2 doub Y N 110 HIS ND1 CE1 doub Y N 111 HIS ND1 HD1 sing N N 112 HIS CD2 NE2 sing Y N 113 HIS CD2 HD2 sing N N 114 HIS CE1 NE2 sing Y N 115 HIS CE1 HE1 sing N N 116 HIS NE2 HE2 sing N N 117 HIS OXT HXT sing N N 118 ILE N CA sing N N 119 ILE N H sing N N 120 ILE N H2 sing N N 121 ILE CA C sing N N 122 ILE CA CB sing N N 123 ILE CA HA sing N N 124 ILE C O doub N N 125 ILE C OXT sing N N 126 ILE CB CG1 sing N N 127 ILE CB CG2 sing N N 128 ILE CB HB sing N N 129 ILE CG1 CD1 sing N N 130 ILE CG1 HG12 sing N N 131 ILE CG1 HG13 sing N N 132 ILE CG2 HG21 sing N N 133 ILE CG2 HG22 sing N N 134 ILE CG2 HG23 sing N N 135 ILE CD1 HD11 sing N N 136 ILE CD1 HD12 sing N N 137 ILE CD1 HD13 sing N N 138 ILE OXT HXT sing N N 139 LYS N CA sing N N 140 LYS N H sing N N 141 LYS N H2 sing N N 142 LYS CA C sing N N 143 LYS CA CB sing N N 144 LYS CA HA sing N N 145 LYS C O doub N N 146 LYS C OXT sing N N 147 LYS CB CG sing N N 148 LYS CB HB2 sing N N 149 LYS CB HB3 sing N N 150 LYS CG CD sing N N 151 LYS CG HG2 sing N N 152 LYS CG HG3 sing N N 153 LYS CD CE sing N N 154 LYS CD HD2 sing N N 155 LYS CD HD3 sing N N 156 LYS CE NZ sing N N 157 LYS CE HE2 sing N N 158 LYS CE HE3 sing N N 159 LYS NZ HZ1 sing N N 160 LYS NZ HZ2 sing N N 161 LYS NZ HZ3 sing N N 162 LYS OXT HXT sing N N 163 MET N CA sing N N 164 MET N H sing N N 165 MET N H2 sing N N 166 MET CA C sing N N 167 MET CA CB sing N N 168 MET CA HA sing N N 169 MET C O doub N N 170 MET C OXT sing N N 171 MET CB CG sing N N 172 MET CB HB2 sing N N 173 MET CB HB3 sing N N 174 MET CG SD sing N N 175 MET CG HG2 sing N N 176 MET CG HG3 sing N N 177 MET SD CE sing N N 178 MET CE HE1 sing N N 179 MET CE HE2 sing N N 180 MET CE HE3 sing N N 181 MET OXT HXT sing N N 182 PHE N CA sing N N 183 PHE N H sing N N 184 PHE N H2 sing N N 185 PHE CA C sing N N 186 PHE CA CB sing N N 187 PHE CA HA sing N N 188 PHE C O doub N N 189 PHE C OXT sing N N 190 PHE CB CG sing N N 191 PHE CB HB2 sing N N 192 PHE CB HB3 sing N N 193 PHE CG CD1 doub Y N 194 PHE CG CD2 sing Y N 195 PHE CD1 CE1 sing Y N 196 PHE CD1 HD1 sing N N 197 PHE CD2 CE2 doub Y N 198 PHE CD2 HD2 sing N N 199 PHE CE1 CZ doub Y N 200 PHE CE1 HE1 sing N N 201 PHE CE2 CZ sing Y N 202 PHE CE2 HE2 sing N N 203 PHE CZ HZ sing N N 204 PHE OXT HXT sing N N 205 PRO N CA sing N N 206 PRO N CD sing N N 207 PRO N H sing N N 208 PRO CA C sing N N 209 PRO CA CB sing N N 210 PRO CA HA sing N N 211 PRO C O doub N N 212 PRO C OXT sing N N 213 PRO CB CG sing N N 214 PRO CB HB2 sing N N 215 PRO CB HB3 sing N N 216 PRO CG CD sing N N 217 PRO CG HG2 sing N N 218 PRO CG HG3 sing N N 219 PRO CD HD2 sing N N 220 PRO CD HD3 sing N N 221 PRO OXT HXT sing N N 222 SER N CA sing N N 223 SER N H sing N N 224 SER N H2 sing N N 225 SER CA C sing N N 226 SER CA CB sing N N 227 SER CA HA sing N N 228 SER C O doub N N 229 SER C OXT sing N N 230 SER CB OG sing N N 231 SER CB HB2 sing N N 232 SER CB HB3 sing N N 233 SER OG HG sing N N 234 SER OXT HXT sing N N 235 THR N CA sing N N 236 THR N H sing N N 237 THR N H2 sing N N 238 THR CA C sing N N 239 THR CA CB sing N N 240 THR CA HA sing N N 241 THR C O doub N N 242 THR C OXT sing N N 243 THR CB OG1 sing N N 244 THR CB CG2 sing N N 245 THR CB HB sing N N 246 THR OG1 HG1 sing N N 247 THR CG2 HG21 sing N N 248 THR CG2 HG22 sing N N 249 THR CG2 HG23 sing N N 250 THR OXT HXT sing N N 251 TYR N CA sing N N 252 TYR N H sing N N 253 TYR N H2 sing N N 254 TYR CA C sing N N 255 TYR CA CB sing N N 256 TYR CA HA sing N N 257 TYR C O doub N N 258 TYR C OXT sing N N 259 TYR CB CG sing N N 260 TYR CB HB2 sing N N 261 TYR CB HB3 sing N N 262 TYR CG CD1 doub Y N 263 TYR CG CD2 sing Y N 264 TYR CD1 CE1 sing Y N 265 TYR CD1 HD1 sing N N 266 TYR CD2 CE2 doub Y N 267 TYR CD2 HD2 sing N N 268 TYR CE1 CZ doub Y N 269 TYR CE1 HE1 sing N N 270 TYR CE2 CZ sing Y N 271 TYR CE2 HE2 sing N N 272 TYR CZ OH sing N N 273 TYR OH HH sing N N 274 TYR OXT HXT sing N N 275 VAL N CA sing N N 276 VAL N H sing N N 277 VAL N H2 sing N N 278 VAL CA C sing N N 279 VAL CA CB sing N N 280 VAL CA HA sing N N 281 VAL C O doub N N 282 VAL C OXT sing N N 283 VAL CB CG1 sing N N 284 VAL CB CG2 sing N N 285 VAL CB HB sing N N 286 VAL CG1 HG11 sing N N 287 VAL CG1 HG12 sing N N 288 VAL CG1 HG13 sing N N 289 VAL CG2 HG21 sing N N 290 VAL CG2 HG22 sing N N 291 VAL CG2 HG23 sing N N 292 VAL OXT HXT sing N N 293 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2YSA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ #