data_2YSB # _entry.id 2YSB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YSB pdb_00002ysb 10.2210/pdb2ysb/pdb RCSB RCSB027071 ? ? WWPDB D_1000027071 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.entry_id 2YSB _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-04-03 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmi002016694.4 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohnishi, S.' 1 'Sato, M.' 2 'Koshiba, S.' 3 'Harada, T.' 4 'Watanabe, S.' 5 'Kigawa, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the first WW domain from the mouse salvador homolog 1 protein (SAV1)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohnishi, S.' 1 ? primary 'Sato, M.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Harada, T.' 4 ? primary 'Watanabe, S.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Salvador homolog 1 protein' _entity.formula_weight 5348.706 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'WW domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name '45 kDa WW domain protein, mWW45' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGEDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLESGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGEDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLESGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmi002016694.4 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 ASP n 1 10 LEU n 1 11 PRO n 1 12 LEU n 1 13 PRO n 1 14 PRO n 1 15 GLY n 1 16 TRP n 1 17 SER n 1 18 VAL n 1 19 ASP n 1 20 TRP n 1 21 THR n 1 22 MET n 1 23 ARG n 1 24 GLY n 1 25 ARG n 1 26 LYS n 1 27 TYR n 1 28 TYR n 1 29 ILE n 1 30 ASP n 1 31 HIS n 1 32 ASN n 1 33 THR n 1 34 ASN n 1 35 THR n 1 36 THR n 1 37 HIS n 1 38 TRP n 1 39 SER n 1 40 HIS n 1 41 PRO n 1 42 LEU n 1 43 GLU n 1 44 SER n 1 45 GLY n 1 46 PRO n 1 47 SER n 1 48 SER n 1 49 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene Sav1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P061010-04 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 GLY 49 49 49 GLY GLY A . n # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2YSB _exptl.crystals_number ? # _struct.entry_id 2YSB _struct.title 'Solution structure of the first WW domain from the mouse salvador homolog 1 protein (SAV1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YSB _struct_keywords.text ;Salvador, WW domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING ; _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SAV1_MOUSE _struct_ref.pdbx_db_accession Q8VEB2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLE _struct_ref.pdbx_align_begin 198 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YSB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 43 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8VEB2 _struct_ref_seq.db_align_beg 198 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 233 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 43 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YSB GLY A 1 ? UNP Q8VEB2 ? ? 'expression tag' 1 1 1 2YSB SER A 2 ? UNP Q8VEB2 ? ? 'expression tag' 2 2 1 2YSB SER A 3 ? UNP Q8VEB2 ? ? 'expression tag' 3 3 1 2YSB GLY A 4 ? UNP Q8VEB2 ? ? 'expression tag' 4 4 1 2YSB SER A 5 ? UNP Q8VEB2 ? ? 'expression tag' 5 5 1 2YSB SER A 6 ? UNP Q8VEB2 ? ? 'expression tag' 6 6 1 2YSB GLY A 7 ? UNP Q8VEB2 ? ? 'expression tag' 7 7 1 2YSB SER A 44 ? UNP Q8VEB2 ? ? 'expression tag' 44 8 1 2YSB GLY A 45 ? UNP Q8VEB2 ? ? 'expression tag' 45 9 1 2YSB PRO A 46 ? UNP Q8VEB2 ? ? 'expression tag' 46 10 1 2YSB SER A 47 ? UNP Q8VEB2 ? ? 'expression tag' 47 11 1 2YSB SER A 48 ? UNP Q8VEB2 ? ? 'expression tag' 48 12 1 2YSB GLY A 49 ? UNP Q8VEB2 ? ? 'expression tag' 49 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 16 ? TRP A 20 ? TRP A 16 TRP A 20 A 2 LYS A 26 ? ASP A 30 ? LYS A 26 ASP A 30 A 3 THR A 35 ? HIS A 37 ? THR A 35 HIS A 37 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 17 ? N SER A 17 O ILE A 29 ? O ILE A 29 A 2 3 N ASP A 30 ? N ASP A 30 O THR A 35 ? O THR A 35 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 9 ? ? 36.83 38.46 2 1 LEU A 10 ? ? -49.36 157.24 3 1 PRO A 11 ? ? -69.82 83.72 4 2 SER A 5 ? ? -36.76 101.26 5 2 ASP A 9 ? ? -99.25 46.06 6 2 LEU A 10 ? ? -42.92 157.31 7 2 PRO A 11 ? ? -69.82 85.76 8 2 ASN A 34 ? ? 74.40 47.90 9 2 PRO A 46 ? ? -69.68 98.48 10 3 ASP A 9 ? ? -76.12 48.80 11 3 LEU A 10 ? ? -42.63 157.12 12 3 PRO A 11 ? ? -69.76 87.28 13 3 ASN A 34 ? ? 74.78 45.05 14 3 GLU A 43 ? ? -64.40 93.93 15 4 SER A 6 ? ? -38.13 117.68 16 4 ASP A 9 ? ? 39.02 34.80 17 4 LEU A 10 ? ? -44.51 156.24 18 4 PRO A 11 ? ? -69.80 81.82 19 4 ASN A 34 ? ? 72.49 47.18 20 4 PRO A 46 ? ? -69.83 1.98 21 5 ASP A 9 ? ? 36.83 39.71 22 5 PRO A 11 ? ? -69.78 82.37 23 5 ASN A 34 ? ? 70.90 46.42 24 6 ASP A 9 ? ? 37.20 38.05 25 6 PRO A 11 ? ? -69.73 82.51 26 6 ASN A 34 ? ? 73.18 47.96 27 6 GLU A 43 ? ? -56.44 100.45 28 6 SER A 44 ? ? -174.74 119.64 29 7 ASP A 9 ? ? 39.60 32.25 30 7 LEU A 10 ? ? -39.00 157.01 31 7 PRO A 11 ? ? -69.73 83.45 32 7 PRO A 46 ? ? -69.74 0.79 33 8 SER A 5 ? ? -48.11 108.02 34 8 ASP A 9 ? ? -77.88 46.78 35 8 LEU A 10 ? ? -42.75 157.31 36 8 PRO A 11 ? ? -69.75 87.00 37 8 ASN A 34 ? ? 73.85 43.60 38 8 GLU A 43 ? ? -58.52 99.75 39 8 SER A 48 ? ? -88.62 42.20 40 9 ASP A 9 ? ? 37.99 36.74 41 9 LEU A 10 ? ? -49.59 157.11 42 9 PRO A 11 ? ? -69.69 84.51 43 9 ASN A 34 ? ? 70.08 49.36 44 10 ASP A 9 ? ? -76.25 48.28 45 10 LEU A 10 ? ? -41.35 157.40 46 10 PRO A 11 ? ? -69.77 85.84 47 10 ASN A 34 ? ? 74.07 47.23 48 10 PRO A 46 ? ? -69.73 -177.33 49 10 SER A 48 ? ? -109.70 42.25 50 11 SER A 3 ? ? -37.50 106.91 51 11 ASP A 9 ? ? -83.91 36.32 52 11 LEU A 10 ? ? -45.63 157.37 53 11 PRO A 11 ? ? -69.77 82.15 54 11 PRO A 46 ? ? -69.81 2.73 55 12 SER A 2 ? ? 36.01 42.22 56 12 SER A 5 ? ? -163.83 117.45 57 12 ASP A 9 ? ? 34.44 43.24 58 12 LEU A 10 ? ? -37.68 153.58 59 12 PRO A 11 ? ? -69.76 88.72 60 13 ASP A 9 ? ? -78.55 45.91 61 13 LEU A 10 ? ? -47.61 157.36 62 13 PRO A 11 ? ? -69.87 85.31 63 13 GLU A 43 ? ? -63.33 98.39 64 14 ASP A 9 ? ? 34.43 42.74 65 14 LEU A 10 ? ? -36.85 155.46 66 14 PRO A 11 ? ? -69.69 83.90 67 14 ASN A 34 ? ? 70.01 43.54 68 14 PRO A 46 ? ? -69.67 2.27 69 15 ASP A 9 ? ? 34.42 42.47 70 15 LEU A 10 ? ? -37.46 156.21 71 15 PRO A 11 ? ? -69.72 80.52 72 15 ASN A 34 ? ? 70.65 43.95 73 15 PRO A 46 ? ? -69.72 1.73 74 16 ASP A 9 ? ? -85.56 37.10 75 16 LEU A 10 ? ? -42.50 156.61 76 16 PRO A 11 ? ? -69.81 85.58 77 16 ASN A 34 ? ? 72.17 48.89 78 17 ASP A 9 ? ? 37.95 37.07 79 17 LEU A 10 ? ? -46.10 157.21 80 17 PRO A 11 ? ? -69.76 82.74 81 18 LEU A 10 ? ? -45.66 156.38 82 18 PRO A 11 ? ? -69.69 84.96 83 18 PRO A 14 ? ? -69.77 99.38 84 19 GLU A 8 ? ? 39.87 27.81 85 19 ASP A 9 ? ? 36.29 40.82 86 19 LEU A 10 ? ? -46.70 157.12 87 19 PRO A 11 ? ? -69.71 84.20 88 20 ASP A 9 ? ? 39.33 33.38 89 20 LEU A 10 ? ? -39.00 154.45 90 20 PRO A 11 ? ? -69.63 80.19 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.entry_id 2YSB _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2YSB # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0mM sample U-15N,13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2YSB _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 GLU N N N N 61 GLU CA C N S 62 GLU C C N N 63 GLU O O N N 64 GLU CB C N N 65 GLU CG C N N 66 GLU CD C N N 67 GLU OE1 O N N 68 GLU OE2 O N N 69 GLU OXT O N N 70 GLU H H N N 71 GLU H2 H N N 72 GLU HA H N N 73 GLU HB2 H N N 74 GLU HB3 H N N 75 GLU HG2 H N N 76 GLU HG3 H N N 77 GLU HE2 H N N 78 GLU HXT H N N 79 GLY N N N N 80 GLY CA C N N 81 GLY C C N N 82 GLY O O N N 83 GLY OXT O N N 84 GLY H H N N 85 GLY H2 H N N 86 GLY HA2 H N N 87 GLY HA3 H N N 88 GLY HXT H N N 89 HIS N N N N 90 HIS CA C N S 91 HIS C C N N 92 HIS O O N N 93 HIS CB C N N 94 HIS CG C Y N 95 HIS ND1 N Y N 96 HIS CD2 C Y N 97 HIS CE1 C Y N 98 HIS NE2 N Y N 99 HIS OXT O N N 100 HIS H H N N 101 HIS H2 H N N 102 HIS HA H N N 103 HIS HB2 H N N 104 HIS HB3 H N N 105 HIS HD1 H N N 106 HIS HD2 H N N 107 HIS HE1 H N N 108 HIS HE2 H N N 109 HIS HXT H N N 110 ILE N N N N 111 ILE CA C N S 112 ILE C C N N 113 ILE O O N N 114 ILE CB C N S 115 ILE CG1 C N N 116 ILE CG2 C N N 117 ILE CD1 C N N 118 ILE OXT O N N 119 ILE H H N N 120 ILE H2 H N N 121 ILE HA H N N 122 ILE HB H N N 123 ILE HG12 H N N 124 ILE HG13 H N N 125 ILE HG21 H N N 126 ILE HG22 H N N 127 ILE HG23 H N N 128 ILE HD11 H N N 129 ILE HD12 H N N 130 ILE HD13 H N N 131 ILE HXT H N N 132 LEU N N N N 133 LEU CA C N S 134 LEU C C N N 135 LEU O O N N 136 LEU CB C N N 137 LEU CG C N N 138 LEU CD1 C N N 139 LEU CD2 C N N 140 LEU OXT O N N 141 LEU H H N N 142 LEU H2 H N N 143 LEU HA H N N 144 LEU HB2 H N N 145 LEU HB3 H N N 146 LEU HG H N N 147 LEU HD11 H N N 148 LEU HD12 H N N 149 LEU HD13 H N N 150 LEU HD21 H N N 151 LEU HD22 H N N 152 LEU HD23 H N N 153 LEU HXT H N N 154 LYS N N N N 155 LYS CA C N S 156 LYS C C N N 157 LYS O O N N 158 LYS CB C N N 159 LYS CG C N N 160 LYS CD C N N 161 LYS CE C N N 162 LYS NZ N N N 163 LYS OXT O N N 164 LYS H H N N 165 LYS H2 H N N 166 LYS HA H N N 167 LYS HB2 H N N 168 LYS HB3 H N N 169 LYS HG2 H N N 170 LYS HG3 H N N 171 LYS HD2 H N N 172 LYS HD3 H N N 173 LYS HE2 H N N 174 LYS HE3 H N N 175 LYS HZ1 H N N 176 LYS HZ2 H N N 177 LYS HZ3 H N N 178 LYS HXT H N N 179 MET N N N N 180 MET CA C N S 181 MET C C N N 182 MET O O N N 183 MET CB C N N 184 MET CG C N N 185 MET SD S N N 186 MET CE C N N 187 MET OXT O N N 188 MET H H N N 189 MET H2 H N N 190 MET HA H N N 191 MET HB2 H N N 192 MET HB3 H N N 193 MET HG2 H N N 194 MET HG3 H N N 195 MET HE1 H N N 196 MET HE2 H N N 197 MET HE3 H N N 198 MET HXT H N N 199 PRO N N N N 200 PRO CA C N S 201 PRO C C N N 202 PRO O O N N 203 PRO CB C N N 204 PRO CG C N N 205 PRO CD C N N 206 PRO OXT O N N 207 PRO H H N N 208 PRO HA H N N 209 PRO HB2 H N N 210 PRO HB3 H N N 211 PRO HG2 H N N 212 PRO HG3 H N N 213 PRO HD2 H N N 214 PRO HD3 H N N 215 PRO HXT H N N 216 SER N N N N 217 SER CA C N S 218 SER C C N N 219 SER O O N N 220 SER CB C N N 221 SER OG O N N 222 SER OXT O N N 223 SER H H N N 224 SER H2 H N N 225 SER HA H N N 226 SER HB2 H N N 227 SER HB3 H N N 228 SER HG H N N 229 SER HXT H N N 230 THR N N N N 231 THR CA C N S 232 THR C C N N 233 THR O O N N 234 THR CB C N R 235 THR OG1 O N N 236 THR CG2 C N N 237 THR OXT O N N 238 THR H H N N 239 THR H2 H N N 240 THR HA H N N 241 THR HB H N N 242 THR HG1 H N N 243 THR HG21 H N N 244 THR HG22 H N N 245 THR HG23 H N N 246 THR HXT H N N 247 TRP N N N N 248 TRP CA C N S 249 TRP C C N N 250 TRP O O N N 251 TRP CB C N N 252 TRP CG C Y N 253 TRP CD1 C Y N 254 TRP CD2 C Y N 255 TRP NE1 N Y N 256 TRP CE2 C Y N 257 TRP CE3 C Y N 258 TRP CZ2 C Y N 259 TRP CZ3 C Y N 260 TRP CH2 C Y N 261 TRP OXT O N N 262 TRP H H N N 263 TRP H2 H N N 264 TRP HA H N N 265 TRP HB2 H N N 266 TRP HB3 H N N 267 TRP HD1 H N N 268 TRP HE1 H N N 269 TRP HE3 H N N 270 TRP HZ2 H N N 271 TRP HZ3 H N N 272 TRP HH2 H N N 273 TRP HXT H N N 274 TYR N N N N 275 TYR CA C N S 276 TYR C C N N 277 TYR O O N N 278 TYR CB C N N 279 TYR CG C Y N 280 TYR CD1 C Y N 281 TYR CD2 C Y N 282 TYR CE1 C Y N 283 TYR CE2 C Y N 284 TYR CZ C Y N 285 TYR OH O N N 286 TYR OXT O N N 287 TYR H H N N 288 TYR H2 H N N 289 TYR HA H N N 290 TYR HB2 H N N 291 TYR HB3 H N N 292 TYR HD1 H N N 293 TYR HD2 H N N 294 TYR HE1 H N N 295 TYR HE2 H N N 296 TYR HH H N N 297 TYR HXT H N N 298 VAL N N N N 299 VAL CA C N S 300 VAL C C N N 301 VAL O O N N 302 VAL CB C N N 303 VAL CG1 C N N 304 VAL CG2 C N N 305 VAL OXT O N N 306 VAL H H N N 307 VAL H2 H N N 308 VAL HA H N N 309 VAL HB H N N 310 VAL HG11 H N N 311 VAL HG12 H N N 312 VAL HG13 H N N 313 VAL HG21 H N N 314 VAL HG22 H N N 315 VAL HG23 H N N 316 VAL HXT H N N 317 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 GLU N CA sing N N 58 GLU N H sing N N 59 GLU N H2 sing N N 60 GLU CA C sing N N 61 GLU CA CB sing N N 62 GLU CA HA sing N N 63 GLU C O doub N N 64 GLU C OXT sing N N 65 GLU CB CG sing N N 66 GLU CB HB2 sing N N 67 GLU CB HB3 sing N N 68 GLU CG CD sing N N 69 GLU CG HG2 sing N N 70 GLU CG HG3 sing N N 71 GLU CD OE1 doub N N 72 GLU CD OE2 sing N N 73 GLU OE2 HE2 sing N N 74 GLU OXT HXT sing N N 75 GLY N CA sing N N 76 GLY N H sing N N 77 GLY N H2 sing N N 78 GLY CA C sing N N 79 GLY CA HA2 sing N N 80 GLY CA HA3 sing N N 81 GLY C O doub N N 82 GLY C OXT sing N N 83 GLY OXT HXT sing N N 84 HIS N CA sing N N 85 HIS N H sing N N 86 HIS N H2 sing N N 87 HIS CA C sing N N 88 HIS CA CB sing N N 89 HIS CA HA sing N N 90 HIS C O doub N N 91 HIS C OXT sing N N 92 HIS CB CG sing N N 93 HIS CB HB2 sing N N 94 HIS CB HB3 sing N N 95 HIS CG ND1 sing Y N 96 HIS CG CD2 doub Y N 97 HIS ND1 CE1 doub Y N 98 HIS ND1 HD1 sing N N 99 HIS CD2 NE2 sing Y N 100 HIS CD2 HD2 sing N N 101 HIS CE1 NE2 sing Y N 102 HIS CE1 HE1 sing N N 103 HIS NE2 HE2 sing N N 104 HIS OXT HXT sing N N 105 ILE N CA sing N N 106 ILE N H sing N N 107 ILE N H2 sing N N 108 ILE CA C sing N N 109 ILE CA CB sing N N 110 ILE CA HA sing N N 111 ILE C O doub N N 112 ILE C OXT sing N N 113 ILE CB CG1 sing N N 114 ILE CB CG2 sing N N 115 ILE CB HB sing N N 116 ILE CG1 CD1 sing N N 117 ILE CG1 HG12 sing N N 118 ILE CG1 HG13 sing N N 119 ILE CG2 HG21 sing N N 120 ILE CG2 HG22 sing N N 121 ILE CG2 HG23 sing N N 122 ILE CD1 HD11 sing N N 123 ILE CD1 HD12 sing N N 124 ILE CD1 HD13 sing N N 125 ILE OXT HXT sing N N 126 LEU N CA sing N N 127 LEU N H sing N N 128 LEU N H2 sing N N 129 LEU CA C sing N N 130 LEU CA CB sing N N 131 LEU CA HA sing N N 132 LEU C O doub N N 133 LEU C OXT sing N N 134 LEU CB CG sing N N 135 LEU CB HB2 sing N N 136 LEU CB HB3 sing N N 137 LEU CG CD1 sing N N 138 LEU CG CD2 sing N N 139 LEU CG HG sing N N 140 LEU CD1 HD11 sing N N 141 LEU CD1 HD12 sing N N 142 LEU CD1 HD13 sing N N 143 LEU CD2 HD21 sing N N 144 LEU CD2 HD22 sing N N 145 LEU CD2 HD23 sing N N 146 LEU OXT HXT sing N N 147 LYS N CA sing N N 148 LYS N H sing N N 149 LYS N H2 sing N N 150 LYS CA C sing N N 151 LYS CA CB sing N N 152 LYS CA HA sing N N 153 LYS C O doub N N 154 LYS C OXT sing N N 155 LYS CB CG sing N N 156 LYS CB HB2 sing N N 157 LYS CB HB3 sing N N 158 LYS CG CD sing N N 159 LYS CG HG2 sing N N 160 LYS CG HG3 sing N N 161 LYS CD CE sing N N 162 LYS CD HD2 sing N N 163 LYS CD HD3 sing N N 164 LYS CE NZ sing N N 165 LYS CE HE2 sing N N 166 LYS CE HE3 sing N N 167 LYS NZ HZ1 sing N N 168 LYS NZ HZ2 sing N N 169 LYS NZ HZ3 sing N N 170 LYS OXT HXT sing N N 171 MET N CA sing N N 172 MET N H sing N N 173 MET N H2 sing N N 174 MET CA C sing N N 175 MET CA CB sing N N 176 MET CA HA sing N N 177 MET C O doub N N 178 MET C OXT sing N N 179 MET CB CG sing N N 180 MET CB HB2 sing N N 181 MET CB HB3 sing N N 182 MET CG SD sing N N 183 MET CG HG2 sing N N 184 MET CG HG3 sing N N 185 MET SD CE sing N N 186 MET CE HE1 sing N N 187 MET CE HE2 sing N N 188 MET CE HE3 sing N N 189 MET OXT HXT sing N N 190 PRO N CA sing N N 191 PRO N CD sing N N 192 PRO N H sing N N 193 PRO CA C sing N N 194 PRO CA CB sing N N 195 PRO CA HA sing N N 196 PRO C O doub N N 197 PRO C OXT sing N N 198 PRO CB CG sing N N 199 PRO CB HB2 sing N N 200 PRO CB HB3 sing N N 201 PRO CG CD sing N N 202 PRO CG HG2 sing N N 203 PRO CG HG3 sing N N 204 PRO CD HD2 sing N N 205 PRO CD HD3 sing N N 206 PRO OXT HXT sing N N 207 SER N CA sing N N 208 SER N H sing N N 209 SER N H2 sing N N 210 SER CA C sing N N 211 SER CA CB sing N N 212 SER CA HA sing N N 213 SER C O doub N N 214 SER C OXT sing N N 215 SER CB OG sing N N 216 SER CB HB2 sing N N 217 SER CB HB3 sing N N 218 SER OG HG sing N N 219 SER OXT HXT sing N N 220 THR N CA sing N N 221 THR N H sing N N 222 THR N H2 sing N N 223 THR CA C sing N N 224 THR CA CB sing N N 225 THR CA HA sing N N 226 THR C O doub N N 227 THR C OXT sing N N 228 THR CB OG1 sing N N 229 THR CB CG2 sing N N 230 THR CB HB sing N N 231 THR OG1 HG1 sing N N 232 THR CG2 HG21 sing N N 233 THR CG2 HG22 sing N N 234 THR CG2 HG23 sing N N 235 THR OXT HXT sing N N 236 TRP N CA sing N N 237 TRP N H sing N N 238 TRP N H2 sing N N 239 TRP CA C sing N N 240 TRP CA CB sing N N 241 TRP CA HA sing N N 242 TRP C O doub N N 243 TRP C OXT sing N N 244 TRP CB CG sing N N 245 TRP CB HB2 sing N N 246 TRP CB HB3 sing N N 247 TRP CG CD1 doub Y N 248 TRP CG CD2 sing Y N 249 TRP CD1 NE1 sing Y N 250 TRP CD1 HD1 sing N N 251 TRP CD2 CE2 doub Y N 252 TRP CD2 CE3 sing Y N 253 TRP NE1 CE2 sing Y N 254 TRP NE1 HE1 sing N N 255 TRP CE2 CZ2 sing Y N 256 TRP CE3 CZ3 doub Y N 257 TRP CE3 HE3 sing N N 258 TRP CZ2 CH2 doub Y N 259 TRP CZ2 HZ2 sing N N 260 TRP CZ3 CH2 sing Y N 261 TRP CZ3 HZ3 sing N N 262 TRP CH2 HH2 sing N N 263 TRP OXT HXT sing N N 264 TYR N CA sing N N 265 TYR N H sing N N 266 TYR N H2 sing N N 267 TYR CA C sing N N 268 TYR CA CB sing N N 269 TYR CA HA sing N N 270 TYR C O doub N N 271 TYR C OXT sing N N 272 TYR CB CG sing N N 273 TYR CB HB2 sing N N 274 TYR CB HB3 sing N N 275 TYR CG CD1 doub Y N 276 TYR CG CD2 sing Y N 277 TYR CD1 CE1 sing Y N 278 TYR CD1 HD1 sing N N 279 TYR CD2 CE2 doub Y N 280 TYR CD2 HD2 sing N N 281 TYR CE1 CZ doub Y N 282 TYR CE1 HE1 sing N N 283 TYR CE2 CZ sing Y N 284 TYR CE2 HE2 sing N N 285 TYR CZ OH sing N N 286 TYR OH HH sing N N 287 TYR OXT HXT sing N N 288 VAL N CA sing N N 289 VAL N H sing N N 290 VAL N H2 sing N N 291 VAL CA C sing N N 292 VAL CA CB sing N N 293 VAL CA HA sing N N 294 VAL C O doub N N 295 VAL C OXT sing N N 296 VAL CB CG1 sing N N 297 VAL CB CG2 sing N N 298 VAL CB HB sing N N 299 VAL CG1 HG11 sing N N 300 VAL CG1 HG12 sing N N 301 VAL CG1 HG13 sing N N 302 VAL CG2 HG21 sing N N 303 VAL CG2 HG22 sing N N 304 VAL CG2 HG23 sing N N 305 VAL OXT HXT sing N N 306 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2YSB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_