data_2YTA # _entry.id 2YTA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YTA pdb_00002yta 10.2210/pdb2yta/pdb RCSB RCSB027106 ? ? WWPDB D_1000027106 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2YTA _pdbx_database_status.recvd_initial_deposition_date 2007-04-05 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002014866.3 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kasahara, N.' 1 'Tsuda, K.' 2 'Muto, Y.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Terada, T.' 6 'Shirouzu, M.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of C2H2 type Zinc finger domain 3 in Zinc finger protein 32' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kasahara, N.' 1 ? primary 'Tsuda, K.' 2 ? primary 'Muto, Y.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Terada, T.' 6 ? primary 'Shirouzu, M.' 7 ? primary 'Yokoyama, S.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 32' 4175.517 1 ? ? 'Zinc-finger motif' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zinc finger protein KOX30, C2H2-546' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGEKPYQCKECGKSFSQRGSLAVHERLHTGSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGEKPYQCKECGKSFSQRGSLAVHERLHTGSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002014866.3 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 LYS n 1 10 PRO n 1 11 TYR n 1 12 GLN n 1 13 CYS n 1 14 LYS n 1 15 GLU n 1 16 CYS n 1 17 GLY n 1 18 LYS n 1 19 SER n 1 20 PHE n 1 21 SER n 1 22 GLN n 1 23 ARG n 1 24 GLY n 1 25 SER n 1 26 LEU n 1 27 ALA n 1 28 VAL n 1 29 HIS n 1 30 GLU n 1 31 ARG n 1 32 LEU n 1 33 HIS n 1 34 THR n 1 35 GLY n 1 36 SER n 1 37 GLY n 1 38 PRO n 1 39 SER n 1 40 SER n 1 41 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'ZNF32, KOX30' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P061204-05 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 129 129 GLY GLY A . n A 1 2 SER 2 130 130 SER SER A . n A 1 3 SER 3 131 131 SER SER A . n A 1 4 GLY 4 132 132 GLY GLY A . n A 1 5 SER 5 133 133 SER SER A . n A 1 6 SER 6 134 134 SER SER A . n A 1 7 GLY 7 135 135 GLY GLY A . n A 1 8 GLU 8 136 136 GLU GLU A . n A 1 9 LYS 9 137 137 LYS LYS A . n A 1 10 PRO 10 138 138 PRO PRO A . n A 1 11 TYR 11 139 139 TYR TYR A . n A 1 12 GLN 12 140 140 GLN GLN A . n A 1 13 CYS 13 141 141 CYS CYS A . n A 1 14 LYS 14 142 142 LYS LYS A . n A 1 15 GLU 15 143 143 GLU GLU A . n A 1 16 CYS 16 144 144 CYS CYS A . n A 1 17 GLY 17 145 145 GLY GLY A . n A 1 18 LYS 18 146 146 LYS LYS A . n A 1 19 SER 19 147 147 SER SER A . n A 1 20 PHE 20 148 148 PHE PHE A . n A 1 21 SER 21 149 149 SER SER A . n A 1 22 GLN 22 150 150 GLN GLN A . n A 1 23 ARG 23 151 151 ARG ARG A . n A 1 24 GLY 24 152 152 GLY GLY A . n A 1 25 SER 25 153 153 SER SER A . n A 1 26 LEU 26 154 154 LEU LEU A . n A 1 27 ALA 27 155 155 ALA ALA A . n A 1 28 VAL 28 156 156 VAL VAL A . n A 1 29 HIS 29 157 157 HIS HIS A . n A 1 30 GLU 30 158 158 GLU GLU A . n A 1 31 ARG 31 159 159 ARG ARG A . n A 1 32 LEU 32 160 160 LEU LEU A . n A 1 33 HIS 33 161 161 HIS HIS A . n A 1 34 THR 34 162 162 THR THR A . n A 1 35 GLY 35 163 163 GLY GLY A . n A 1 36 SER 36 164 164 SER SER A . n A 1 37 GLY 37 165 165 GLY GLY A . n A 1 38 PRO 38 166 166 PRO PRO A . n A 1 39 SER 39 167 167 SER SER A . n A 1 40 SER 40 168 168 SER SER A . n A 1 41 GLY 41 169 169 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 2YTA _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2YTA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2YTA _struct.title 'Solution structure of C2H2 type Zinc finger domain 3 in Zinc finger protein 32' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YTA _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;Zinc-finger domain, C2H2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZNF32_HUMAN _struct_ref.pdbx_db_accession P17041 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EKPYQCKECGKSFSQRGSLAVHERLHTG _struct_ref.pdbx_align_begin 129 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YTA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P17041 _struct_ref_seq.db_align_beg 129 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 156 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 136 _struct_ref_seq.pdbx_auth_seq_align_end 163 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YTA GLY A 1 ? UNP P17041 ? ? 'expression tag' 129 1 1 2YTA SER A 2 ? UNP P17041 ? ? 'expression tag' 130 2 1 2YTA SER A 3 ? UNP P17041 ? ? 'expression tag' 131 3 1 2YTA GLY A 4 ? UNP P17041 ? ? 'expression tag' 132 4 1 2YTA SER A 5 ? UNP P17041 ? ? 'expression tag' 133 5 1 2YTA SER A 6 ? UNP P17041 ? ? 'expression tag' 134 6 1 2YTA GLY A 7 ? UNP P17041 ? ? 'expression tag' 135 7 1 2YTA SER A 36 ? UNP P17041 ? ? 'expression tag' 164 8 1 2YTA GLY A 37 ? UNP P17041 ? ? 'expression tag' 165 9 1 2YTA PRO A 38 ? UNP P17041 ? ? 'expression tag' 166 10 1 2YTA SER A 39 ? UNP P17041 ? ? 'expression tag' 167 11 1 2YTA SER A 40 ? UNP P17041 ? ? 'expression tag' 168 12 1 2YTA GLY A 41 ? UNP P17041 ? ? 'expression tag' 169 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 22 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 32 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 150 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 160 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 13 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 141 A ZN 201 1_555 ? ? ? ? ? ? ? 2.388 ? ? metalc2 metalc ? ? A CYS 16 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 144 A ZN 201 1_555 ? ? ? ? ? ? ? 2.189 ? ? metalc3 metalc ? ? A HIS 29 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 157 A ZN 201 1_555 ? ? ? ? ? ? ? 2.094 ? ? metalc4 metalc ? ? A HIS 33 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 161 A ZN 201 1_555 ? ? ? ? ? ? ? 1.979 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 13 ? A CYS 141 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 16 ? A CYS 144 ? 1_555 115.4 ? 2 SG ? A CYS 13 ? A CYS 141 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 29 ? A HIS 157 ? 1_555 111.1 ? 3 SG ? A CYS 16 ? A CYS 144 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 29 ? A HIS 157 ? 1_555 101.4 ? 4 SG ? A CYS 13 ? A CYS 141 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 33 ? A HIS 161 ? 1_555 98.8 ? 5 SG ? A CYS 16 ? A CYS 144 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 33 ? A HIS 161 ? 1_555 124.0 ? 6 NE2 ? A HIS 29 ? A HIS 157 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 33 ? A HIS 161 ? 1_555 106.0 ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 13 ? CYS A 141 . ? 1_555 ? 2 AC1 4 CYS A 16 ? CYS A 144 . ? 1_555 ? 3 AC1 4 HIS A 29 ? HIS A 157 . ? 1_555 ? 4 AC1 4 HIS A 33 ? HIS A 161 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 167 ? ? -172.92 -65.66 2 2 SER A 133 ? ? -160.10 34.56 3 2 PRO A 166 ? ? -69.79 -176.02 4 2 SER A 168 ? ? -63.94 -71.62 5 3 SER A 130 ? ? -152.60 28.08 6 3 SER A 131 ? ? 59.42 179.83 7 3 SER A 164 ? ? 58.70 -172.38 8 4 SER A 133 ? ? 59.06 71.17 9 4 SER A 164 ? ? 61.72 172.11 10 5 PRO A 166 ? ? -69.69 78.72 11 5 SER A 168 ? ? -178.63 -73.88 12 6 SER A 131 ? ? -144.57 42.96 13 6 SER A 134 ? ? -140.43 -42.51 14 6 SER A 164 ? ? 57.71 77.53 15 6 SER A 167 ? ? -169.01 -45.45 16 7 SER A 133 ? ? 55.90 -171.01 17 7 SER A 134 ? ? -145.84 45.27 18 7 PRO A 166 ? ? -69.76 -171.22 19 7 SER A 168 ? ? -105.22 41.19 20 8 SER A 164 ? ? 60.59 -177.45 21 8 PRO A 166 ? ? -69.76 78.91 22 8 SER A 168 ? ? -179.24 -71.18 23 9 SER A 164 ? ? 62.61 165.06 24 9 PRO A 166 ? ? -69.76 78.78 25 9 SER A 168 ? ? -178.57 -68.80 26 10 SER A 133 ? ? -170.12 39.67 27 10 PRO A 166 ? ? -69.79 -179.29 28 11 SER A 134 ? ? -157.44 -55.73 29 11 LYS A 146 ? ? -69.79 -179.56 30 11 PRO A 166 ? ? -69.79 -171.35 31 12 SER A 164 ? ? -171.60 -64.01 32 12 PRO A 166 ? ? -69.79 92.57 33 12 SER A 167 ? ? 55.45 90.91 34 13 SER A 131 ? ? -175.06 135.11 35 13 PRO A 166 ? ? -69.72 -173.21 36 14 SER A 133 ? ? -104.02 63.53 37 14 SER A 164 ? ? 62.51 98.51 38 14 PRO A 166 ? ? -69.78 -172.48 39 14 SER A 168 ? ? -94.21 -67.11 40 15 SER A 130 ? ? 63.14 162.72 41 16 SER A 133 ? ? -177.22 145.00 42 16 SER A 134 ? ? -142.40 31.66 43 16 SER A 164 ? ? -125.62 -68.60 44 16 PRO A 166 ? ? -69.78 -172.27 45 16 SER A 168 ? ? -103.55 -74.12 46 17 SER A 130 ? ? 52.81 -170.74 47 17 SER A 133 ? ? 58.96 90.97 48 17 PRO A 166 ? ? -69.83 -170.03 49 17 SER A 167 ? ? -53.81 102.08 50 18 PRO A 166 ? ? -69.76 -175.34 51 18 SER A 168 ? ? -81.39 -72.49 52 19 SER A 164 ? ? 57.16 94.10 53 19 SER A 167 ? ? -157.66 -57.94 54 20 PRO A 166 ? ? -69.75 -173.04 55 20 SER A 168 ? ? -96.50 -72.85 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2YTA _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2YTA _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20mM d-Tris-HCl(pH7.0), 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 0.05mM ZnCl2 +1mM IDA, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2YTA _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20060702 Delaglio,F 2 'data analysis' NMRView 5.0.4 Jonson,B.A 3 'data analysis' KUJIRA 0.9820 Kobayashi,N 4 'structure solution' CYANA 2.0.17 Gutert,P 5 refinement CYANA 2.0.17 Gutert,P 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 CYS N N N N 41 CYS CA C N R 42 CYS C C N N 43 CYS O O N N 44 CYS CB C N N 45 CYS SG S N N 46 CYS OXT O N N 47 CYS H H N N 48 CYS H2 H N N 49 CYS HA H N N 50 CYS HB2 H N N 51 CYS HB3 H N N 52 CYS HG H N N 53 CYS HXT H N N 54 GLN N N N N 55 GLN CA C N S 56 GLN C C N N 57 GLN O O N N 58 GLN CB C N N 59 GLN CG C N N 60 GLN CD C N N 61 GLN OE1 O N N 62 GLN NE2 N N N 63 GLN OXT O N N 64 GLN H H N N 65 GLN H2 H N N 66 GLN HA H N N 67 GLN HB2 H N N 68 GLN HB3 H N N 69 GLN HG2 H N N 70 GLN HG3 H N N 71 GLN HE21 H N N 72 GLN HE22 H N N 73 GLN HXT H N N 74 GLU N N N N 75 GLU CA C N S 76 GLU C C N N 77 GLU O O N N 78 GLU CB C N N 79 GLU CG C N N 80 GLU CD C N N 81 GLU OE1 O N N 82 GLU OE2 O N N 83 GLU OXT O N N 84 GLU H H N N 85 GLU H2 H N N 86 GLU HA H N N 87 GLU HB2 H N N 88 GLU HB3 H N N 89 GLU HG2 H N N 90 GLU HG3 H N N 91 GLU HE2 H N N 92 GLU HXT H N N 93 GLY N N N N 94 GLY CA C N N 95 GLY C C N N 96 GLY O O N N 97 GLY OXT O N N 98 GLY H H N N 99 GLY H2 H N N 100 GLY HA2 H N N 101 GLY HA3 H N N 102 GLY HXT H N N 103 HIS N N N N 104 HIS CA C N S 105 HIS C C N N 106 HIS O O N N 107 HIS CB C N N 108 HIS CG C Y N 109 HIS ND1 N Y N 110 HIS CD2 C Y N 111 HIS CE1 C Y N 112 HIS NE2 N Y N 113 HIS OXT O N N 114 HIS H H N N 115 HIS H2 H N N 116 HIS HA H N N 117 HIS HB2 H N N 118 HIS HB3 H N N 119 HIS HD1 H N N 120 HIS HD2 H N N 121 HIS HE1 H N N 122 HIS HE2 H N N 123 HIS HXT H N N 124 LEU N N N N 125 LEU CA C N S 126 LEU C C N N 127 LEU O O N N 128 LEU CB C N N 129 LEU CG C N N 130 LEU CD1 C N N 131 LEU CD2 C N N 132 LEU OXT O N N 133 LEU H H N N 134 LEU H2 H N N 135 LEU HA H N N 136 LEU HB2 H N N 137 LEU HB3 H N N 138 LEU HG H N N 139 LEU HD11 H N N 140 LEU HD12 H N N 141 LEU HD13 H N N 142 LEU HD21 H N N 143 LEU HD22 H N N 144 LEU HD23 H N N 145 LEU HXT H N N 146 LYS N N N N 147 LYS CA C N S 148 LYS C C N N 149 LYS O O N N 150 LYS CB C N N 151 LYS CG C N N 152 LYS CD C N N 153 LYS CE C N N 154 LYS NZ N N N 155 LYS OXT O N N 156 LYS H H N N 157 LYS H2 H N N 158 LYS HA H N N 159 LYS HB2 H N N 160 LYS HB3 H N N 161 LYS HG2 H N N 162 LYS HG3 H N N 163 LYS HD2 H N N 164 LYS HD3 H N N 165 LYS HE2 H N N 166 LYS HE3 H N N 167 LYS HZ1 H N N 168 LYS HZ2 H N N 169 LYS HZ3 H N N 170 LYS HXT H N N 171 PHE N N N N 172 PHE CA C N S 173 PHE C C N N 174 PHE O O N N 175 PHE CB C N N 176 PHE CG C Y N 177 PHE CD1 C Y N 178 PHE CD2 C Y N 179 PHE CE1 C Y N 180 PHE CE2 C Y N 181 PHE CZ C Y N 182 PHE OXT O N N 183 PHE H H N N 184 PHE H2 H N N 185 PHE HA H N N 186 PHE HB2 H N N 187 PHE HB3 H N N 188 PHE HD1 H N N 189 PHE HD2 H N N 190 PHE HE1 H N N 191 PHE HE2 H N N 192 PHE HZ H N N 193 PHE HXT H N N 194 PRO N N N N 195 PRO CA C N S 196 PRO C C N N 197 PRO O O N N 198 PRO CB C N N 199 PRO CG C N N 200 PRO CD C N N 201 PRO OXT O N N 202 PRO H H N N 203 PRO HA H N N 204 PRO HB2 H N N 205 PRO HB3 H N N 206 PRO HG2 H N N 207 PRO HG3 H N N 208 PRO HD2 H N N 209 PRO HD3 H N N 210 PRO HXT H N N 211 SER N N N N 212 SER CA C N S 213 SER C C N N 214 SER O O N N 215 SER CB C N N 216 SER OG O N N 217 SER OXT O N N 218 SER H H N N 219 SER H2 H N N 220 SER HA H N N 221 SER HB2 H N N 222 SER HB3 H N N 223 SER HG H N N 224 SER HXT H N N 225 THR N N N N 226 THR CA C N S 227 THR C C N N 228 THR O O N N 229 THR CB C N R 230 THR OG1 O N N 231 THR CG2 C N N 232 THR OXT O N N 233 THR H H N N 234 THR H2 H N N 235 THR HA H N N 236 THR HB H N N 237 THR HG1 H N N 238 THR HG21 H N N 239 THR HG22 H N N 240 THR HG23 H N N 241 THR HXT H N N 242 TYR N N N N 243 TYR CA C N S 244 TYR C C N N 245 TYR O O N N 246 TYR CB C N N 247 TYR CG C Y N 248 TYR CD1 C Y N 249 TYR CD2 C Y N 250 TYR CE1 C Y N 251 TYR CE2 C Y N 252 TYR CZ C Y N 253 TYR OH O N N 254 TYR OXT O N N 255 TYR H H N N 256 TYR H2 H N N 257 TYR HA H N N 258 TYR HB2 H N N 259 TYR HB3 H N N 260 TYR HD1 H N N 261 TYR HD2 H N N 262 TYR HE1 H N N 263 TYR HE2 H N N 264 TYR HH H N N 265 TYR HXT H N N 266 VAL N N N N 267 VAL CA C N S 268 VAL C C N N 269 VAL O O N N 270 VAL CB C N N 271 VAL CG1 C N N 272 VAL CG2 C N N 273 VAL OXT O N N 274 VAL H H N N 275 VAL H2 H N N 276 VAL HA H N N 277 VAL HB H N N 278 VAL HG11 H N N 279 VAL HG12 H N N 280 VAL HG13 H N N 281 VAL HG21 H N N 282 VAL HG22 H N N 283 VAL HG23 H N N 284 VAL HXT H N N 285 ZN ZN ZN N N 286 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 CYS N CA sing N N 39 CYS N H sing N N 40 CYS N H2 sing N N 41 CYS CA C sing N N 42 CYS CA CB sing N N 43 CYS CA HA sing N N 44 CYS C O doub N N 45 CYS C OXT sing N N 46 CYS CB SG sing N N 47 CYS CB HB2 sing N N 48 CYS CB HB3 sing N N 49 CYS SG HG sing N N 50 CYS OXT HXT sing N N 51 GLN N CA sing N N 52 GLN N H sing N N 53 GLN N H2 sing N N 54 GLN CA C sing N N 55 GLN CA CB sing N N 56 GLN CA HA sing N N 57 GLN C O doub N N 58 GLN C OXT sing N N 59 GLN CB CG sing N N 60 GLN CB HB2 sing N N 61 GLN CB HB3 sing N N 62 GLN CG CD sing N N 63 GLN CG HG2 sing N N 64 GLN CG HG3 sing N N 65 GLN CD OE1 doub N N 66 GLN CD NE2 sing N N 67 GLN NE2 HE21 sing N N 68 GLN NE2 HE22 sing N N 69 GLN OXT HXT sing N N 70 GLU N CA sing N N 71 GLU N H sing N N 72 GLU N H2 sing N N 73 GLU CA C sing N N 74 GLU CA CB sing N N 75 GLU CA HA sing N N 76 GLU C O doub N N 77 GLU C OXT sing N N 78 GLU CB CG sing N N 79 GLU CB HB2 sing N N 80 GLU CB HB3 sing N N 81 GLU CG CD sing N N 82 GLU CG HG2 sing N N 83 GLU CG HG3 sing N N 84 GLU CD OE1 doub N N 85 GLU CD OE2 sing N N 86 GLU OE2 HE2 sing N N 87 GLU OXT HXT sing N N 88 GLY N CA sing N N 89 GLY N H sing N N 90 GLY N H2 sing N N 91 GLY CA C sing N N 92 GLY CA HA2 sing N N 93 GLY CA HA3 sing N N 94 GLY C O doub N N 95 GLY C OXT sing N N 96 GLY OXT HXT sing N N 97 HIS N CA sing N N 98 HIS N H sing N N 99 HIS N H2 sing N N 100 HIS CA C sing N N 101 HIS CA CB sing N N 102 HIS CA HA sing N N 103 HIS C O doub N N 104 HIS C OXT sing N N 105 HIS CB CG sing N N 106 HIS CB HB2 sing N N 107 HIS CB HB3 sing N N 108 HIS CG ND1 sing Y N 109 HIS CG CD2 doub Y N 110 HIS ND1 CE1 doub Y N 111 HIS ND1 HD1 sing N N 112 HIS CD2 NE2 sing Y N 113 HIS CD2 HD2 sing N N 114 HIS CE1 NE2 sing Y N 115 HIS CE1 HE1 sing N N 116 HIS NE2 HE2 sing N N 117 HIS OXT HXT sing N N 118 LEU N CA sing N N 119 LEU N H sing N N 120 LEU N H2 sing N N 121 LEU CA C sing N N 122 LEU CA CB sing N N 123 LEU CA HA sing N N 124 LEU C O doub N N 125 LEU C OXT sing N N 126 LEU CB CG sing N N 127 LEU CB HB2 sing N N 128 LEU CB HB3 sing N N 129 LEU CG CD1 sing N N 130 LEU CG CD2 sing N N 131 LEU CG HG sing N N 132 LEU CD1 HD11 sing N N 133 LEU CD1 HD12 sing N N 134 LEU CD1 HD13 sing N N 135 LEU CD2 HD21 sing N N 136 LEU CD2 HD22 sing N N 137 LEU CD2 HD23 sing N N 138 LEU OXT HXT sing N N 139 LYS N CA sing N N 140 LYS N H sing N N 141 LYS N H2 sing N N 142 LYS CA C sing N N 143 LYS CA CB sing N N 144 LYS CA HA sing N N 145 LYS C O doub N N 146 LYS C OXT sing N N 147 LYS CB CG sing N N 148 LYS CB HB2 sing N N 149 LYS CB HB3 sing N N 150 LYS CG CD sing N N 151 LYS CG HG2 sing N N 152 LYS CG HG3 sing N N 153 LYS CD CE sing N N 154 LYS CD HD2 sing N N 155 LYS CD HD3 sing N N 156 LYS CE NZ sing N N 157 LYS CE HE2 sing N N 158 LYS CE HE3 sing N N 159 LYS NZ HZ1 sing N N 160 LYS NZ HZ2 sing N N 161 LYS NZ HZ3 sing N N 162 LYS OXT HXT sing N N 163 PHE N CA sing N N 164 PHE N H sing N N 165 PHE N H2 sing N N 166 PHE CA C sing N N 167 PHE CA CB sing N N 168 PHE CA HA sing N N 169 PHE C O doub N N 170 PHE C OXT sing N N 171 PHE CB CG sing N N 172 PHE CB HB2 sing N N 173 PHE CB HB3 sing N N 174 PHE CG CD1 doub Y N 175 PHE CG CD2 sing Y N 176 PHE CD1 CE1 sing Y N 177 PHE CD1 HD1 sing N N 178 PHE CD2 CE2 doub Y N 179 PHE CD2 HD2 sing N N 180 PHE CE1 CZ doub Y N 181 PHE CE1 HE1 sing N N 182 PHE CE2 CZ sing Y N 183 PHE CE2 HE2 sing N N 184 PHE CZ HZ sing N N 185 PHE OXT HXT sing N N 186 PRO N CA sing N N 187 PRO N CD sing N N 188 PRO N H sing N N 189 PRO CA C sing N N 190 PRO CA CB sing N N 191 PRO CA HA sing N N 192 PRO C O doub N N 193 PRO C OXT sing N N 194 PRO CB CG sing N N 195 PRO CB HB2 sing N N 196 PRO CB HB3 sing N N 197 PRO CG CD sing N N 198 PRO CG HG2 sing N N 199 PRO CG HG3 sing N N 200 PRO CD HD2 sing N N 201 PRO CD HD3 sing N N 202 PRO OXT HXT sing N N 203 SER N CA sing N N 204 SER N H sing N N 205 SER N H2 sing N N 206 SER CA C sing N N 207 SER CA CB sing N N 208 SER CA HA sing N N 209 SER C O doub N N 210 SER C OXT sing N N 211 SER CB OG sing N N 212 SER CB HB2 sing N N 213 SER CB HB3 sing N N 214 SER OG HG sing N N 215 SER OXT HXT sing N N 216 THR N CA sing N N 217 THR N H sing N N 218 THR N H2 sing N N 219 THR CA C sing N N 220 THR CA CB sing N N 221 THR CA HA sing N N 222 THR C O doub N N 223 THR C OXT sing N N 224 THR CB OG1 sing N N 225 THR CB CG2 sing N N 226 THR CB HB sing N N 227 THR OG1 HG1 sing N N 228 THR CG2 HG21 sing N N 229 THR CG2 HG22 sing N N 230 THR CG2 HG23 sing N N 231 THR OXT HXT sing N N 232 TYR N CA sing N N 233 TYR N H sing N N 234 TYR N H2 sing N N 235 TYR CA C sing N N 236 TYR CA CB sing N N 237 TYR CA HA sing N N 238 TYR C O doub N N 239 TYR C OXT sing N N 240 TYR CB CG sing N N 241 TYR CB HB2 sing N N 242 TYR CB HB3 sing N N 243 TYR CG CD1 doub Y N 244 TYR CG CD2 sing Y N 245 TYR CD1 CE1 sing Y N 246 TYR CD1 HD1 sing N N 247 TYR CD2 CE2 doub Y N 248 TYR CD2 HD2 sing N N 249 TYR CE1 CZ doub Y N 250 TYR CE1 HE1 sing N N 251 TYR CE2 CZ sing Y N 252 TYR CE2 HE2 sing N N 253 TYR CZ OH sing N N 254 TYR OH HH sing N N 255 TYR OXT HXT sing N N 256 VAL N CA sing N N 257 VAL N H sing N N 258 VAL N H2 sing N N 259 VAL CA C sing N N 260 VAL CA CB sing N N 261 VAL CA HA sing N N 262 VAL C O doub N N 263 VAL C OXT sing N N 264 VAL CB CG1 sing N N 265 VAL CB CG2 sing N N 266 VAL CB HB sing N N 267 VAL CG1 HG11 sing N N 268 VAL CG1 HG12 sing N N 269 VAL CG1 HG13 sing N N 270 VAL CG2 HG21 sing N N 271 VAL CG2 HG22 sing N N 272 VAL CG2 HG23 sing N N 273 VAL OXT HXT sing N N 274 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2YTA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_