data_2YUU # _entry.id 2YUU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YUU pdb_00002yuu 10.2210/pdb2yuu/pdb RCSB RCSB027162 ? ? WWPDB D_1000027162 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-08 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif 8 3 'Structure model' struct_site 9 4 'Structure model' chem_comp_atom 10 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_conn.pdbx_dist_value' 6 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 9 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 3 'Structure model' '_struct_ref_seq_dif.details' 19 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 20 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 21 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2YUU _pdbx_database_status.recvd_initial_deposition_date 2007-04-06 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso002000689.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Abe, H.' 1 'Miyamoto, K.' 2 'Tochio, N.' 3 'Saito, K.' 4 'Sasagawa, A.' 5 'Koshiba, S.' 6 'Inoue, M.' 7 'Kigawa, T.' 8 'Yokoyama, S.' 9 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 10 # _citation.id primary _citation.title 'Solution structure of the first Phorbol esters/diacylglycerol binding domain of human Protein kinase C, delta' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Abe, H.' 1 ? primary 'Miyamoto, K.' 2 ? primary 'Tochio, N.' 3 ? primary 'Saito, K.' 4 ? primary 'Sasagawa, A.' 5 ? primary 'Koshiba, S.' 6 ? primary 'Inoue, M.' 7 ? primary 'Kigawa, T.' 8 ? primary 'Yokoyama, S.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein kinase C delta type' 8961.199 1 2.7.11.13 ? 'Phorbol esters/diacylglycerol binding domain (C1 domain)' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name nPKC-delta # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTSGP SSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTSGP SSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso002000689.1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LYS n 1 9 GLN n 1 10 ALA n 1 11 LYS n 1 12 ILE n 1 13 HIS n 1 14 TYR n 1 15 ILE n 1 16 LYS n 1 17 ASN n 1 18 HIS n 1 19 GLU n 1 20 PHE n 1 21 ILE n 1 22 ALA n 1 23 THR n 1 24 PHE n 1 25 PHE n 1 26 GLY n 1 27 GLN n 1 28 PRO n 1 29 THR n 1 30 PHE n 1 31 CYS n 1 32 SER n 1 33 VAL n 1 34 CYS n 1 35 LYS n 1 36 ASP n 1 37 PHE n 1 38 VAL n 1 39 TRP n 1 40 GLY n 1 41 LEU n 1 42 ASN n 1 43 LYS n 1 44 GLN n 1 45 GLY n 1 46 TYR n 1 47 LYS n 1 48 CYS n 1 49 ARG n 1 50 GLN n 1 51 CYS n 1 52 ASN n 1 53 ALA n 1 54 ALA n 1 55 ILE n 1 56 HIS n 1 57 LYS n 1 58 LYS n 1 59 CYS n 1 60 ILE n 1 61 ASP n 1 62 LYS n 1 63 ILE n 1 64 ILE n 1 65 GLY n 1 66 ARG n 1 67 CYS n 1 68 THR n 1 69 GLY n 1 70 THR n 1 71 ALA n 1 72 ALA n 1 73 ASN n 1 74 SER n 1 75 ARG n 1 76 ASP n 1 77 THR n 1 78 SER n 1 79 GLY n 1 80 PRO n 1 81 SER n 1 82 SER n 1 83 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene PRKCD _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050302-69 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 GLY 83 83 83 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _exptl.entry_id 2YUU _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2YUU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2YUU _struct.title 'Solution structure of the first Phorbol esters/diacylglycerol binding domain of human Protein kinase C, delta' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YUU _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;Metal Binding Protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KPCD_HUMAN _struct_ref.pdbx_db_accession Q05655 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDT _struct_ref.pdbx_align_begin 149 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YUU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q05655 _struct_ref_seq.db_align_beg 149 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 218 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 77 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YUU GLY A 1 ? UNP Q05655 ? ? 'expression tag' 1 1 1 2YUU SER A 2 ? UNP Q05655 ? ? 'expression tag' 2 2 1 2YUU SER A 3 ? UNP Q05655 ? ? 'expression tag' 3 3 1 2YUU GLY A 4 ? UNP Q05655 ? ? 'expression tag' 4 4 1 2YUU SER A 5 ? UNP Q05655 ? ? 'expression tag' 5 5 1 2YUU SER A 6 ? UNP Q05655 ? ? 'expression tag' 6 6 1 2YUU GLY A 7 ? UNP Q05655 ? ? 'expression tag' 7 7 1 2YUU SER A 78 ? UNP Q05655 ? ? 'expression tag' 78 8 1 2YUU GLY A 79 ? UNP Q05655 ? ? 'expression tag' 79 9 1 2YUU PRO A 80 ? UNP Q05655 ? ? 'expression tag' 80 10 1 2YUU SER A 81 ? UNP Q05655 ? ? 'expression tag' 81 11 1 2YUU SER A 82 ? UNP Q05655 ? ? 'expression tag' 82 12 1 2YUU GLY A 83 ? UNP Q05655 ? ? 'expression tag' 83 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 14 ? HIS A 18 ? TYR A 14 HIS A 18 5 ? 5 HELX_P HELX_P2 2 LYS A 58 ? LYS A 62 ? LYS A 58 LYS A 62 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 18 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.081 ? ? metalc2 metalc ? ? A CYS 31 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 31 A ZN 401 1_555 ? ? ? ? ? ? ? 2.323 ? ? metalc3 metalc ? ? A CYS 34 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 34 A ZN 401 1_555 ? ? ? ? ? ? ? 2.367 ? ? metalc4 metalc ? ? A CYS 48 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 48 A ZN 201 1_555 ? ? ? ? ? ? ? 2.365 ? ? metalc5 metalc ? ? A CYS 51 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 51 A ZN 201 1_555 ? ? ? ? ? ? ? 2.293 ? ? metalc6 metalc ? ? A HIS 56 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 56 A ZN 401 1_555 ? ? ? ? ? ? ? 2.004 ? ? metalc7 metalc ? ? A CYS 59 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 59 A ZN 401 1_555 ? ? ? ? ? ? ? 2.237 ? ? metalc8 metalc ? ? A CYS 67 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 67 A ZN 201 1_555 ? ? ? ? ? ? ? 2.360 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 18 ? A HIS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 113.4 ? 2 ND1 ? A HIS 18 ? A HIS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 116.0 ? 3 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 100.1 ? 4 ND1 ? A HIS 18 ? A HIS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 67 ? A CYS 67 ? 1_555 97.6 ? 5 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 67 ? A CYS 67 ? 1_555 113.8 ? 6 SG ? A CYS 51 ? A CYS 51 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 67 ? A CYS 67 ? 1_555 116.7 ? 7 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 108.7 ? 8 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 56 ? A HIS 56 ? 1_555 100.5 ? 9 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 56 ? A HIS 56 ? 1_555 98.5 ? 10 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 59 ? A CYS 59 ? 1_555 120.4 ? 11 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 59 ? A CYS 59 ? 1_555 103.5 ? 12 ND1 ? A HIS 56 ? A HIS 56 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 59 ? A CYS 59 ? 1_555 122.7 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 12 ? HIS A 13 ? ILE A 12 HIS A 13 A 2 PHE A 20 ? THR A 23 ? PHE A 20 THR A 23 A 3 GLY A 45 ? CYS A 48 ? GLY A 45 CYS A 48 A 4 ALA A 54 ? ILE A 55 ? ALA A 54 ILE A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 13 ? N HIS A 13 O PHE A 20 ? O PHE A 20 A 2 3 N ILE A 21 ? N ILE A 21 O LYS A 47 ? O LYS A 47 A 3 4 N TYR A 46 ? N TYR A 46 O ILE A 55 ? O ILE A 55 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 3 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 2 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 HIS A 18 ? HIS A 18 . ? 1_555 ? 2 AC1 3 GLU A 19 ? GLU A 19 . ? 1_555 ? 3 AC1 3 PHE A 20 ? PHE A 20 . ? 1_555 ? 4 AC2 2 CYS A 31 ? CYS A 31 . ? 1_555 ? 5 AC2 2 CYS A 34 ? CYS A 34 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 20 ? ? -38.22 110.11 2 1 PRO A 28 ? ? -69.74 86.37 3 1 VAL A 33 ? ? -73.08 -71.43 4 1 LYS A 35 ? ? 71.81 45.83 5 1 ASN A 42 ? ? -38.85 99.43 6 1 ILE A 63 ? ? -35.44 139.97 7 1 ASN A 73 ? ? -40.27 153.02 8 1 SER A 81 ? ? -170.55 110.19 9 2 TYR A 14 ? ? -77.34 49.75 10 2 PRO A 28 ? ? -69.80 84.01 11 2 VAL A 33 ? ? -71.61 -70.02 12 2 PHE A 37 ? ? -35.43 104.95 13 2 VAL A 38 ? ? -68.72 78.86 14 2 LYS A 43 ? ? -34.89 100.28 15 2 GLN A 44 ? ? -37.46 143.25 16 2 ALA A 71 ? ? -101.36 73.85 17 2 ARG A 75 ? ? -105.66 46.34 18 2 ASP A 76 ? ? -105.79 41.83 19 2 THR A 77 ? ? -86.64 40.94 20 2 PRO A 80 ? ? -69.63 -175.85 21 3 LYS A 8 ? ? -164.91 113.40 22 3 PRO A 28 ? ? -69.74 85.41 23 3 VAL A 33 ? ? -73.53 -70.06 24 3 PHE A 37 ? ? -57.60 86.51 25 3 VAL A 38 ? ? -65.40 75.45 26 3 SER A 74 ? ? -163.84 110.20 27 3 THR A 77 ? ? -34.98 106.35 28 3 SER A 78 ? ? -173.10 149.43 29 4 SER A 2 ? ? -171.84 120.23 30 4 LYS A 11 ? ? -36.28 117.64 31 4 LYS A 16 ? ? 45.23 26.19 32 4 ASN A 17 ? ? 74.90 35.67 33 4 PRO A 28 ? ? -69.80 81.95 34 4 PHE A 37 ? ? -48.15 92.49 35 4 ASN A 52 ? ? 70.25 54.56 36 4 ILE A 63 ? ? -35.21 140.79 37 4 ARG A 75 ? ? -173.68 121.96 38 4 SER A 78 ? ? -170.50 133.18 39 5 SER A 6 ? ? -40.06 153.32 40 5 LYS A 16 ? ? 46.70 25.14 41 5 ASN A 17 ? ? 74.95 34.56 42 5 PHE A 20 ? ? -39.09 106.64 43 5 PRO A 28 ? ? -69.81 83.59 44 5 VAL A 33 ? ? -72.15 -70.21 45 5 PHE A 37 ? ? -32.06 102.83 46 5 ASN A 42 ? ? 39.86 39.95 47 5 ALA A 71 ? ? -109.60 42.02 48 5 SER A 78 ? ? 34.59 42.13 49 5 SER A 82 ? ? -38.15 136.28 50 6 SER A 5 ? ? -174.79 131.79 51 6 LYS A 16 ? ? 39.61 34.55 52 6 PRO A 28 ? ? -69.75 80.00 53 6 VAL A 33 ? ? -71.60 -70.16 54 6 PHE A 37 ? ? -34.14 101.51 55 6 VAL A 38 ? ? -66.86 74.77 56 6 LEU A 41 ? ? -45.13 168.49 57 6 ASN A 42 ? ? -64.06 76.91 58 6 SER A 74 ? ? -55.43 97.08 59 6 SER A 78 ? ? 71.81 42.87 60 6 SER A 81 ? ? -173.01 148.81 61 6 SER A 82 ? ? -60.28 92.23 62 7 LYS A 16 ? ? 44.59 26.26 63 7 ASN A 17 ? ? 74.32 36.43 64 7 PHE A 20 ? ? -44.91 109.48 65 7 PRO A 28 ? ? -69.69 98.93 66 7 VAL A 33 ? ? -75.03 -71.49 67 7 LEU A 41 ? ? -174.50 125.79 68 7 ASN A 42 ? ? -58.57 81.99 69 7 GLN A 50 ? ? -107.78 -69.90 70 7 ILE A 63 ? ? -35.00 146.85 71 7 ILE A 64 ? ? -122.41 -51.06 72 7 ARG A 75 ? ? -37.79 124.66 73 7 SER A 78 ? ? -38.83 122.57 74 8 LYS A 16 ? ? 45.64 25.47 75 8 ASN A 17 ? ? 74.45 35.77 76 8 PRO A 28 ? ? -69.80 93.08 77 8 ILE A 63 ? ? -35.32 150.10 78 8 ILE A 64 ? ? -130.73 -39.65 79 8 ALA A 72 ? ? -132.53 -61.57 80 8 ASN A 73 ? ? -44.19 102.53 81 8 SER A 74 ? ? -173.24 140.87 82 8 ARG A 75 ? ? -44.28 159.44 83 8 ASP A 76 ? ? -41.75 151.48 84 9 SER A 6 ? ? -58.93 177.24 85 9 LYS A 8 ? ? -56.13 178.09 86 9 PHE A 20 ? ? -45.32 109.31 87 9 PRO A 28 ? ? -69.83 80.24 88 9 LYS A 35 ? ? 72.86 52.46 89 9 PHE A 37 ? ? -33.46 115.28 90 9 VAL A 38 ? ? -78.87 44.87 91 9 ILE A 63 ? ? -33.93 141.17 92 9 ALA A 72 ? ? 70.04 41.58 93 9 ASP A 76 ? ? -51.98 175.59 94 10 LYS A 16 ? ? 45.92 25.92 95 10 ASN A 17 ? ? 73.63 35.74 96 10 PHE A 20 ? ? -42.37 106.57 97 10 PRO A 28 ? ? -69.77 83.75 98 10 PHE A 37 ? ? -36.35 94.70 99 10 VAL A 38 ? ? -66.17 79.13 100 10 LEU A 41 ? ? -62.52 99.28 101 10 ASN A 52 ? ? 73.23 53.20 102 10 ASP A 76 ? ? -57.40 176.84 103 10 THR A 77 ? ? -40.07 105.30 104 10 SER A 81 ? ? -108.88 42.13 105 11 LYS A 16 ? ? 46.48 27.73 106 11 ASN A 17 ? ? 71.86 34.58 107 11 PHE A 20 ? ? -41.75 109.26 108 11 PRO A 28 ? ? -69.79 81.01 109 11 VAL A 33 ? ? -64.21 -70.40 110 11 PHE A 37 ? ? -33.94 100.26 111 11 GLN A 44 ? ? -46.25 170.41 112 11 ASN A 52 ? ? 73.60 54.97 113 11 ILE A 63 ? ? -33.72 139.97 114 11 ASN A 73 ? ? -43.46 167.43 115 11 ARG A 75 ? ? -37.94 147.06 116 11 THR A 77 ? ? -36.22 152.60 117 11 SER A 81 ? ? -56.37 95.81 118 12 LYS A 16 ? ? 45.54 26.32 119 12 ASN A 17 ? ? 74.58 35.55 120 12 PRO A 28 ? ? -69.74 82.66 121 12 PHE A 37 ? ? -34.45 101.48 122 12 LEU A 41 ? ? -93.75 49.82 123 12 LYS A 43 ? ? -171.08 128.96 124 12 GLN A 44 ? ? -38.40 148.07 125 12 GLN A 50 ? ? -98.12 -60.73 126 12 ARG A 75 ? ? -38.08 149.83 127 12 THR A 77 ? ? -38.95 152.98 128 13 LYS A 11 ? ? -34.83 121.11 129 13 TYR A 14 ? ? -76.98 48.85 130 13 PHE A 20 ? ? -48.84 107.75 131 13 PRO A 28 ? ? -69.69 81.30 132 13 PHE A 37 ? ? -38.11 119.79 133 13 ASN A 42 ? ? -34.00 -70.57 134 13 LYS A 43 ? ? -102.33 -67.45 135 13 ILE A 63 ? ? -35.87 144.78 136 13 ALA A 71 ? ? -34.39 148.15 137 13 SER A 74 ? ? -54.46 171.44 138 13 THR A 77 ? ? -35.14 140.07 139 14 TYR A 14 ? ? -76.79 49.26 140 14 PRO A 28 ? ? -69.64 80.01 141 14 VAL A 33 ? ? -66.91 -70.28 142 14 PHE A 37 ? ? -31.96 117.50 143 14 ASN A 42 ? ? 73.63 44.20 144 15 SER A 2 ? ? -162.20 119.44 145 15 LYS A 16 ? ? 45.27 26.22 146 15 ASN A 17 ? ? 73.57 36.22 147 15 PHE A 20 ? ? -40.51 105.88 148 15 PRO A 28 ? ? -69.77 84.44 149 15 THR A 29 ? ? -68.79 -174.34 150 15 VAL A 33 ? ? -65.61 -70.85 151 15 PHE A 37 ? ? -33.74 98.62 152 15 VAL A 38 ? ? -67.73 75.55 153 15 ASN A 42 ? ? 37.73 42.14 154 15 GLN A 44 ? ? -45.53 158.51 155 15 ALA A 71 ? ? -102.91 40.58 156 15 ASN A 73 ? ? -48.79 106.18 157 16 LYS A 16 ? ? 45.87 25.09 158 16 ASN A 17 ? ? 74.55 35.67 159 16 PRO A 28 ? ? -69.70 80.46 160 16 LYS A 35 ? ? 70.29 54.25 161 16 PHE A 37 ? ? -33.97 95.68 162 16 TRP A 39 ? ? -48.43 162.80 163 16 LEU A 41 ? ? -34.06 128.05 164 16 GLN A 50 ? ? -108.41 -61.60 165 16 ASN A 52 ? ? 70.94 52.28 166 16 ILE A 63 ? ? -33.44 146.16 167 16 ILE A 64 ? ? -128.47 -52.80 168 16 ALA A 71 ? ? -33.73 97.67 169 16 ALA A 72 ? ? -35.42 130.66 170 16 ARG A 75 ? ? -47.95 102.02 171 17 LYS A 16 ? ? 46.66 25.10 172 17 ASN A 17 ? ? 74.07 34.95 173 17 PRO A 28 ? ? -69.73 91.58 174 17 VAL A 33 ? ? -80.44 -70.55 175 17 LYS A 35 ? ? 70.95 50.80 176 17 LYS A 43 ? ? -50.99 99.51 177 17 ILE A 63 ? ? -33.51 135.56 178 17 ARG A 75 ? ? 38.79 41.95 179 17 PRO A 80 ? ? -69.77 -176.74 180 18 LYS A 16 ? ? 45.06 26.67 181 18 ASN A 17 ? ? 74.79 35.54 182 18 PHE A 20 ? ? -35.90 106.45 183 18 PRO A 28 ? ? -69.71 89.93 184 18 PHE A 37 ? ? -34.14 106.32 185 18 ASN A 42 ? ? -84.69 39.43 186 18 GLN A 50 ? ? -108.75 -66.65 187 18 ILE A 63 ? ? -32.86 146.60 188 18 ALA A 72 ? ? -41.51 155.52 189 18 ARG A 75 ? ? -67.81 80.85 190 19 SER A 3 ? ? -174.99 143.74 191 19 SER A 5 ? ? -122.85 -51.50 192 19 SER A 6 ? ? 34.35 46.14 193 19 ALA A 10 ? ? -173.33 -175.30 194 19 LYS A 16 ? ? 45.35 26.30 195 19 ASN A 17 ? ? 74.89 35.03 196 19 PHE A 20 ? ? -37.92 112.20 197 19 PRO A 28 ? ? -69.70 91.33 198 19 ASN A 42 ? ? -40.97 93.65 199 19 ASN A 52 ? ? 71.88 51.83 200 19 ILE A 63 ? ? -34.82 150.53 201 19 ILE A 64 ? ? -131.75 -43.29 202 19 SER A 74 ? ? -36.11 153.17 203 19 ARG A 75 ? ? -38.79 124.23 204 19 THR A 77 ? ? -82.93 41.91 205 19 SER A 81 ? ? -69.92 87.07 206 20 LYS A 16 ? ? 45.91 25.11 207 20 ASN A 17 ? ? 73.52 36.04 208 20 PHE A 20 ? ? -46.63 109.40 209 20 PRO A 28 ? ? -69.77 83.00 210 20 PHE A 37 ? ? -33.35 101.81 211 20 LEU A 41 ? ? -39.27 124.25 212 20 GLN A 50 ? ? -109.62 -61.61 213 20 ILE A 63 ? ? -33.40 143.46 214 20 ARG A 75 ? ? -80.41 44.90 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2YUU _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2YUU _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.28mM Protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3 ;0.05mM ZnCl2+1mM IDA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2YUU _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMNMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9747 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TRP N N N N 298 TRP CA C N S 299 TRP C C N N 300 TRP O O N N 301 TRP CB C N N 302 TRP CG C Y N 303 TRP CD1 C Y N 304 TRP CD2 C Y N 305 TRP NE1 N Y N 306 TRP CE2 C Y N 307 TRP CE3 C Y N 308 TRP CZ2 C Y N 309 TRP CZ3 C Y N 310 TRP CH2 C Y N 311 TRP OXT O N N 312 TRP H H N N 313 TRP H2 H N N 314 TRP HA H N N 315 TRP HB2 H N N 316 TRP HB3 H N N 317 TRP HD1 H N N 318 TRP HE1 H N N 319 TRP HE3 H N N 320 TRP HZ2 H N N 321 TRP HZ3 H N N 322 TRP HH2 H N N 323 TRP HXT H N N 324 TYR N N N N 325 TYR CA C N S 326 TYR C C N N 327 TYR O O N N 328 TYR CB C N N 329 TYR CG C Y N 330 TYR CD1 C Y N 331 TYR CD2 C Y N 332 TYR CE1 C Y N 333 TYR CE2 C Y N 334 TYR CZ C Y N 335 TYR OH O N N 336 TYR OXT O N N 337 TYR H H N N 338 TYR H2 H N N 339 TYR HA H N N 340 TYR HB2 H N N 341 TYR HB3 H N N 342 TYR HD1 H N N 343 TYR HD2 H N N 344 TYR HE1 H N N 345 TYR HE2 H N N 346 TYR HH H N N 347 TYR HXT H N N 348 VAL N N N N 349 VAL CA C N S 350 VAL C C N N 351 VAL O O N N 352 VAL CB C N N 353 VAL CG1 C N N 354 VAL CG2 C N N 355 VAL OXT O N N 356 VAL H H N N 357 VAL H2 H N N 358 VAL HA H N N 359 VAL HB H N N 360 VAL HG11 H N N 361 VAL HG12 H N N 362 VAL HG13 H N N 363 VAL HG21 H N N 364 VAL HG22 H N N 365 VAL HG23 H N N 366 VAL HXT H N N 367 ZN ZN ZN N N 368 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TRP N CA sing N N 285 TRP N H sing N N 286 TRP N H2 sing N N 287 TRP CA C sing N N 288 TRP CA CB sing N N 289 TRP CA HA sing N N 290 TRP C O doub N N 291 TRP C OXT sing N N 292 TRP CB CG sing N N 293 TRP CB HB2 sing N N 294 TRP CB HB3 sing N N 295 TRP CG CD1 doub Y N 296 TRP CG CD2 sing Y N 297 TRP CD1 NE1 sing Y N 298 TRP CD1 HD1 sing N N 299 TRP CD2 CE2 doub Y N 300 TRP CD2 CE3 sing Y N 301 TRP NE1 CE2 sing Y N 302 TRP NE1 HE1 sing N N 303 TRP CE2 CZ2 sing Y N 304 TRP CE3 CZ3 doub Y N 305 TRP CE3 HE3 sing N N 306 TRP CZ2 CH2 doub Y N 307 TRP CZ2 HZ2 sing N N 308 TRP CZ3 CH2 sing Y N 309 TRP CZ3 HZ3 sing N N 310 TRP CH2 HH2 sing N N 311 TRP OXT HXT sing N N 312 TYR N CA sing N N 313 TYR N H sing N N 314 TYR N H2 sing N N 315 TYR CA C sing N N 316 TYR CA CB sing N N 317 TYR CA HA sing N N 318 TYR C O doub N N 319 TYR C OXT sing N N 320 TYR CB CG sing N N 321 TYR CB HB2 sing N N 322 TYR CB HB3 sing N N 323 TYR CG CD1 doub Y N 324 TYR CG CD2 sing Y N 325 TYR CD1 CE1 sing Y N 326 TYR CD1 HD1 sing N N 327 TYR CD2 CE2 doub Y N 328 TYR CD2 HD2 sing N N 329 TYR CE1 CZ doub Y N 330 TYR CE1 HE1 sing N N 331 TYR CE2 CZ sing Y N 332 TYR CE2 HE2 sing N N 333 TYR CZ OH sing N N 334 TYR OH HH sing N N 335 TYR OXT HXT sing N N 336 VAL N CA sing N N 337 VAL N H sing N N 338 VAL N H2 sing N N 339 VAL CA C sing N N 340 VAL CA CB sing N N 341 VAL CA HA sing N N 342 VAL C O doub N N 343 VAL C OXT sing N N 344 VAL CB CG1 sing N N 345 VAL CB CG2 sing N N 346 VAL CB HB sing N N 347 VAL CG1 HG11 sing N N 348 VAL CG1 HG12 sing N N 349 VAL CG1 HG13 sing N N 350 VAL CG2 HG21 sing N N 351 VAL CG2 HG22 sing N N 352 VAL CG2 HG23 sing N N 353 VAL OXT HXT sing N N 354 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2YUU _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_