data_2YW4 # _entry.id 2YW4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2YW4 RCSB RCSB027208 WWPDB D_1000027208 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2YW3 'The same protein in complex with PO4' unspecified TargetDB ttk003002241.2 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2YW4 _pdbx_database_status.recvd_initial_deposition_date 2007-04-19 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kawano, Y.' 1 'Hashimoto, K.' 2 'Kamiya, N.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Crystal Structure Analysis of the 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3-deoxyphosphogluconate aldolase from TTHB1' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kawano, Y.' 1 primary 'Hashimoto, K.' 2 primary 'Kamiya, N.' 3 # _cell.entry_id 2YW4 _cell.length_a 66.686 _cell.length_b 66.686 _cell.length_c 241.301 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2YW4 _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '4-hydroxy-2-oxoglutarate aldolase/2-deydro-3-deoxyphosphogluconate aldolase' 21745.330 1 4.1.2.14 ? ? ? 2 water nat water 18.015 62 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEGMDPLAVLAESRLLPLLTVRGGEDLLGLARVLEEEGVGALEITLRTEKGLEALKALRKSGLLLGAGTVRSPKEAEAAL EAGAAFLVSPGLLEEVAALAQARGVPYLPGVLTPTEVERALALGLSALKFFPAEPFQGVRVLRAYAEVFPEVRFLPTGGI KEEHLPHYAALPNLLAVGGSWLLQGNLEAVRAKVRAAKALLSPQAPG ; _entity_poly.pdbx_seq_one_letter_code_can ;MEGMDPLAVLAESRLLPLLTVRGGEDLLGLARVLEEEGVGALEITLRTEKGLEALKALRKSGLLLGAGTVRSPKEAEAAL EAGAAFLVSPGLLEEVAALAQARGVPYLPGVLTPTEVERALALGLSALKFFPAEPFQGVRVLRAYAEVFPEVRFLPTGGI KEEHLPHYAALPNLLAVGGSWLLQGNLEAVRAKVRAAKALLSPQAPG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ttk003002241.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 GLY n 1 4 MET n 1 5 ASP n 1 6 PRO n 1 7 LEU n 1 8 ALA n 1 9 VAL n 1 10 LEU n 1 11 ALA n 1 12 GLU n 1 13 SER n 1 14 ARG n 1 15 LEU n 1 16 LEU n 1 17 PRO n 1 18 LEU n 1 19 LEU n 1 20 THR n 1 21 VAL n 1 22 ARG n 1 23 GLY n 1 24 GLY n 1 25 GLU n 1 26 ASP n 1 27 LEU n 1 28 LEU n 1 29 GLY n 1 30 LEU n 1 31 ALA n 1 32 ARG n 1 33 VAL n 1 34 LEU n 1 35 GLU n 1 36 GLU n 1 37 GLU n 1 38 GLY n 1 39 VAL n 1 40 GLY n 1 41 ALA n 1 42 LEU n 1 43 GLU n 1 44 ILE n 1 45 THR n 1 46 LEU n 1 47 ARG n 1 48 THR n 1 49 GLU n 1 50 LYS n 1 51 GLY n 1 52 LEU n 1 53 GLU n 1 54 ALA n 1 55 LEU n 1 56 LYS n 1 57 ALA n 1 58 LEU n 1 59 ARG n 1 60 LYS n 1 61 SER n 1 62 GLY n 1 63 LEU n 1 64 LEU n 1 65 LEU n 1 66 GLY n 1 67 ALA n 1 68 GLY n 1 69 THR n 1 70 VAL n 1 71 ARG n 1 72 SER n 1 73 PRO n 1 74 LYS n 1 75 GLU n 1 76 ALA n 1 77 GLU n 1 78 ALA n 1 79 ALA n 1 80 LEU n 1 81 GLU n 1 82 ALA n 1 83 GLY n 1 84 ALA n 1 85 ALA n 1 86 PHE n 1 87 LEU n 1 88 VAL n 1 89 SER n 1 90 PRO n 1 91 GLY n 1 92 LEU n 1 93 LEU n 1 94 GLU n 1 95 GLU n 1 96 VAL n 1 97 ALA n 1 98 ALA n 1 99 LEU n 1 100 ALA n 1 101 GLN n 1 102 ALA n 1 103 ARG n 1 104 GLY n 1 105 VAL n 1 106 PRO n 1 107 TYR n 1 108 LEU n 1 109 PRO n 1 110 GLY n 1 111 VAL n 1 112 LEU n 1 113 THR n 1 114 PRO n 1 115 THR n 1 116 GLU n 1 117 VAL n 1 118 GLU n 1 119 ARG n 1 120 ALA n 1 121 LEU n 1 122 ALA n 1 123 LEU n 1 124 GLY n 1 125 LEU n 1 126 SER n 1 127 ALA n 1 128 LEU n 1 129 LYS n 1 130 PHE n 1 131 PHE n 1 132 PRO n 1 133 ALA n 1 134 GLU n 1 135 PRO n 1 136 PHE n 1 137 GLN n 1 138 GLY n 1 139 VAL n 1 140 ARG n 1 141 VAL n 1 142 LEU n 1 143 ARG n 1 144 ALA n 1 145 TYR n 1 146 ALA n 1 147 GLU n 1 148 VAL n 1 149 PHE n 1 150 PRO n 1 151 GLU n 1 152 VAL n 1 153 ARG n 1 154 PHE n 1 155 LEU n 1 156 PRO n 1 157 THR n 1 158 GLY n 1 159 GLY n 1 160 ILE n 1 161 LYS n 1 162 GLU n 1 163 GLU n 1 164 HIS n 1 165 LEU n 1 166 PRO n 1 167 HIS n 1 168 TYR n 1 169 ALA n 1 170 ALA n 1 171 LEU n 1 172 PRO n 1 173 ASN n 1 174 LEU n 1 175 LEU n 1 176 ALA n 1 177 VAL n 1 178 GLY n 1 179 GLY n 1 180 SER n 1 181 TRP n 1 182 LEU n 1 183 LEU n 1 184 GLN n 1 185 GLY n 1 186 ASN n 1 187 LEU n 1 188 GLU n 1 189 ALA n 1 190 VAL n 1 191 ARG n 1 192 ALA n 1 193 LYS n 1 194 VAL n 1 195 ARG n 1 196 ALA n 1 197 ALA n 1 198 LYS n 1 199 ALA n 1 200 LEU n 1 201 LEU n 1 202 SER n 1 203 PRO n 1 204 GLN n 1 205 ALA n 1 206 PRO n 1 207 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Thermus thermophilus' _entity_src_gen.gene_src_strain HB8 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 300852 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q53W90_THET8 _struct_ref.pdbx_db_accession Q53W90 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEGMDPLAVLAESRLLPLLTVRGGEDLLGLARVLEEEGVGALEITLRTEKGLEALKALRKSGLLLGAGTVRSPKEAEAAL EAGAAFLVSPGLLEEVAALAQARGVPYLPGVLTPTEVERALALGLSALKFFPAEPFQGVRVLRAYAEVFPEVRFLPTGGI KEEHLPHYAALPNLLAVGGSWLLQGNLEAVRAKVRAAKALLSPQAPG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YW4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 207 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q53W90 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 207 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 207 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2YW4 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.37 _exptl_crystal.density_percent_sol 48.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 301 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_details ;0.2M Calcium Chloride dihydrate, 0.1M Sodium Acetate trihydrate, 20% v/v iso-Propanol, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 301K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS V' _diffrn_detector.pdbx_collection_date 2005-05-22 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Conforcul mirror' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU FR-D' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 2YW4 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 2.53 _reflns.d_resolution_low 30.80 _reflns.number_all 7273 _reflns.number_obs 7273 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.055 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 33.47 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 10.1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.53 _reflns_shell.d_res_low 2.62 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.298 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 8.55 _reflns_shell.pdbx_redundancy 10.2 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 697 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2YW4 _refine.ls_number_reflns_obs 6558 _refine.ls_number_reflns_all 6558 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.80 _refine.ls_d_res_high 2.53 _refine.ls_percent_reflns_obs 100.00 _refine.ls_R_factor_obs 0.171 _refine.ls_R_factor_all 0.171 _refine.ls_R_factor_R_work 0.164 _refine.ls_R_factor_R_free 0.241 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.8 _refine.ls_number_reflns_R_free 712 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.950 _refine.correlation_coeff_Fo_to_Fc_free 0.872 _refine.B_iso_mean 24.301 _refine.aniso_B[1][1] 0.57 _refine.aniso_B[2][2] 0.57 _refine.aniso_B[3][3] -0.85 _refine.aniso_B[1][2] 0.28 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1MXS' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.868 _refine.pdbx_overall_ESU_R_Free 0.306 _refine.overall_SU_ML 0.189 _refine.overall_SU_B 8.462 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1483 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 62 _refine_hist.number_atoms_total 1545 _refine_hist.d_res_high 2.53 _refine_hist.d_res_low 30.80 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.033 0.022 ? 1508 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2.580 2.026 ? 2049 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 7.018 5.000 ? 199 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 36.292 22.830 ? 53 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 21.226 15.000 ? 252 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 18.869 15.000 ? 13 'X-RAY DIFFRACTION' ? r_chiral_restr 0.163 0.200 ? 246 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.011 0.020 ? 1113 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.260 0.200 ? 765 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.327 0.200 ? 1006 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.189 0.200 ? 81 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.255 0.200 ? 50 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.278 0.200 ? 7 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.807 1.500 ? 1020 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.751 2.000 ? 1569 'X-RAY DIFFRACTION' ? r_scbond_it 4.478 3.000 ? 540 'X-RAY DIFFRACTION' ? r_scangle_it 7.347 4.500 ? 480 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.527 _refine_ls_shell.d_res_low 2.592 _refine_ls_shell.number_reflns_R_work 459 _refine_ls_shell.R_factor_R_work 0.183 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.27 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 57 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2YW4 _struct.title 'Crystal Structure Analysis of the 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3-deoxyphosphogluconate aldolase from TTHB1' _struct.pdbx_descriptor '4-hydroxy-2-oxoglutarate aldolase/2-deydro-3-deoxyphosphogluconate aldolase (E.C.4.1.2.14)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YW4 _struct_keywords.pdbx_keywords LYASE _struct_keywords.text ;aldolase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LYASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 7 ? ARG A 14 ? LEU A 7 ARG A 14 1 ? 8 HELX_P HELX_P2 2 ASP A 26 ? GLU A 37 ? ASP A 26 GLU A 37 1 ? 12 HELX_P HELX_P3 3 THR A 48 ? ARG A 59 ? THR A 48 ARG A 59 1 ? 12 HELX_P HELX_P4 4 SER A 72 ? ALA A 82 ? SER A 72 ALA A 82 1 ? 11 HELX_P HELX_P5 5 LEU A 93 ? GLY A 104 ? LEU A 93 GLY A 104 1 ? 12 HELX_P HELX_P6 6 THR A 113 ? LEU A 123 ? THR A 113 LEU A 123 1 ? 11 HELX_P HELX_P7 7 GLN A 137 ? PHE A 149 ? GLN A 137 PHE A 149 1 ? 13 HELX_P HELX_P8 8 LYS A 161 ? GLU A 163 ? LYS A 161 GLU A 163 5 ? 3 HELX_P HELX_P9 9 HIS A 164 ? ALA A 170 ? HIS A 164 ALA A 170 1 ? 7 HELX_P HELX_P10 10 SER A 180 ? GLN A 184 ? SER A 180 GLN A 184 5 ? 5 HELX_P HELX_P11 11 ASN A 186 ? LEU A 201 ? ASN A 186 LEU A 201 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 131 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 131 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 132 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 132 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.43 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? parallel A 7 8 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 153 ? PRO A 156 ? ARG A 153 PRO A 156 A 2 ALA A 127 ? PHE A 130 ? ALA A 127 PHE A 130 A 3 TYR A 107 ? VAL A 111 ? TYR A 107 VAL A 111 A 4 PHE A 86 ? SER A 89 ? PHE A 86 SER A 89 A 5 LEU A 64 ? GLY A 68 ? LEU A 64 GLY A 68 A 6 ALA A 41 ? THR A 45 ? ALA A 41 THR A 45 A 7 LEU A 15 ? LEU A 19 ? LEU A 15 LEU A 19 A 8 VAL A 177 ? GLY A 179 ? VAL A 177 GLY A 179 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 155 ? O LEU A 155 N LEU A 128 ? N LEU A 128 A 2 3 O LYS A 129 ? O LYS A 129 N VAL A 111 ? N VAL A 111 A 3 4 O LEU A 108 ? O LEU A 108 N LEU A 87 ? N LEU A 87 A 4 5 O VAL A 88 ? O VAL A 88 N ALA A 67 ? N ALA A 67 A 5 6 O GLY A 66 ? O GLY A 66 N LEU A 42 ? N LEU A 42 A 6 7 O GLU A 43 ? O GLU A 43 N LEU A 19 ? N LEU A 19 A 7 8 N LEU A 18 ? N LEU A 18 O GLY A 179 ? O GLY A 179 # _database_PDB_matrix.entry_id 2YW4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2YW4 _atom_sites.fract_transf_matrix[1][1] 0.014996 _atom_sites.fract_transf_matrix[1][2] 0.008658 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017315 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004144 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 HIS 164 164 164 HIS HIS A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 PRO 166 166 166 PRO PRO A . n A 1 167 HIS 167 167 167 HIS HIS A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 TRP 181 181 181 TRP TRP A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 ASN 186 186 186 ASN ASN A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 ARG 191 191 191 ARG ARG A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 ARG 195 195 195 ARG ARG A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 LYS 198 198 198 LYS LYS A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 SER 202 202 202 SER ALA A . n A 1 203 PRO 203 203 203 PRO ALA A . n A 1 204 GLN 204 204 ? ? ? A . n A 1 205 ALA 205 205 ? ? ? A . n A 1 206 PRO 206 206 ? ? ? A . n A 1 207 GLY 207 207 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 208 1 HOH HOH A . B 2 HOH 2 209 2 HOH HOH A . B 2 HOH 3 210 3 HOH HOH A . B 2 HOH 4 211 4 HOH HOH A . B 2 HOH 5 212 5 HOH HOH A . B 2 HOH 6 213 6 HOH HOH A . B 2 HOH 7 214 7 HOH HOH A . B 2 HOH 8 215 8 HOH HOH A . B 2 HOH 9 216 9 HOH HOH A . B 2 HOH 10 217 10 HOH HOH A . B 2 HOH 11 218 11 HOH HOH A . B 2 HOH 12 219 12 HOH HOH A . B 2 HOH 13 220 13 HOH HOH A . B 2 HOH 14 221 14 HOH HOH A . B 2 HOH 15 222 15 HOH HOH A . B 2 HOH 16 223 16 HOH HOH A . B 2 HOH 17 224 17 HOH HOH A . B 2 HOH 18 225 18 HOH HOH A . B 2 HOH 19 226 19 HOH HOH A . B 2 HOH 20 227 20 HOH HOH A . B 2 HOH 21 228 21 HOH HOH A . B 2 HOH 22 229 22 HOH HOH A . B 2 HOH 23 230 23 HOH HOH A . B 2 HOH 24 231 24 HOH HOH A . B 2 HOH 25 232 25 HOH HOH A . B 2 HOH 26 233 26 HOH HOH A . B 2 HOH 27 234 27 HOH HOH A . B 2 HOH 28 235 28 HOH HOH A . B 2 HOH 29 236 29 HOH HOH A . B 2 HOH 30 237 30 HOH HOH A . B 2 HOH 31 238 31 HOH HOH A . B 2 HOH 32 239 32 HOH HOH A . B 2 HOH 33 240 33 HOH HOH A . B 2 HOH 34 241 34 HOH HOH A . B 2 HOH 35 242 35 HOH HOH A . B 2 HOH 36 243 36 HOH HOH A . B 2 HOH 37 244 37 HOH HOH A . B 2 HOH 38 245 38 HOH HOH A . B 2 HOH 39 246 39 HOH HOH A . B 2 HOH 40 247 40 HOH HOH A . B 2 HOH 41 248 41 HOH HOH A . B 2 HOH 42 249 42 HOH HOH A . B 2 HOH 43 250 43 HOH HOH A . B 2 HOH 44 251 44 HOH HOH A . B 2 HOH 45 252 45 HOH HOH A . B 2 HOH 46 253 46 HOH HOH A . B 2 HOH 47 254 47 HOH HOH A . B 2 HOH 48 255 48 HOH HOH A . B 2 HOH 49 256 49 HOH HOH A . B 2 HOH 50 257 50 HOH HOH A . B 2 HOH 51 258 51 HOH HOH A . B 2 HOH 52 259 52 HOH HOH A . B 2 HOH 53 260 53 HOH HOH A . B 2 HOH 54 261 54 HOH HOH A . B 2 HOH 55 262 55 HOH HOH A . B 2 HOH 56 263 56 HOH HOH A . B 2 HOH 57 264 57 HOH HOH A . B 2 HOH 58 265 59 HOH HOH A . B 2 HOH 59 266 60 HOH HOH A . B 2 HOH 60 267 61 HOH HOH A . B 2 HOH 61 268 63 HOH HOH A . B 2 HOH 62 269 65 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_685 -y+1,x-y+3,z -0.5000000000 -0.8660254038 0.0000000000 -33.3430000000 0.8660254038 -0.5000000000 0.0000000000 173.2553102303 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_365 -x+y-2,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -166.7150000000 -0.8660254038 -0.5000000000 0.0000000000 57.7517700768 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-23 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Source and taxonomy' 2 2 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 CrystalClear 'data collection' . ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 CNS phasing . ? 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLN _pdbx_validate_close_contact.auth_seq_id_1 101 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 269 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.11 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CA A ALA 78 ? ? CB A ALA 78 ? ? 1.696 1.520 0.176 0.021 N 2 1 CG A PHE 86 ? ? CD2 A PHE 86 ? ? 1.475 1.383 0.092 0.015 N 3 1 CZ A PHE 86 ? ? CE2 A PHE 86 ? ? 1.497 1.369 0.128 0.019 N 4 1 CG A GLU 94 ? ? CD A GLU 94 ? ? 1.615 1.515 0.100 0.015 N 5 1 CD A GLU 94 ? ? OE2 A GLU 94 ? ? 1.345 1.252 0.093 0.011 N 6 1 CG A GLU 95 ? ? CD A GLU 95 ? ? 1.632 1.515 0.117 0.015 N 7 1 CG A GLU 134 ? ? CD A GLU 134 ? ? 1.615 1.515 0.100 0.015 N 8 1 CG A GLU 147 ? ? CD A GLU 147 ? ? 1.637 1.515 0.122 0.015 N 9 1 CG A GLU 151 ? ? CD A GLU 151 ? ? 1.615 1.515 0.100 0.015 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 59 ? ? CZ A ARG 59 ? ? NH2 A ARG 59 ? ? 123.41 120.30 3.11 0.50 N 2 1 CB A LEU 112 ? ? CG A LEU 112 ? ? CD1 A LEU 112 ? ? 97.24 111.00 -13.76 1.70 N 3 1 NE A ARG 119 ? ? CZ A ARG 119 ? ? NH1 A ARG 119 ? ? 125.75 120.30 5.45 0.50 N 4 1 NE A ARG 119 ? ? CZ A ARG 119 ? ? NH2 A ARG 119 ? ? 115.14 120.30 -5.16 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 46 ? ? -93.58 32.95 2 1 ARG A 59 ? ? -38.79 -39.41 3 1 LEU A 112 ? ? -138.44 -48.34 4 1 GLN A 137 ? ? 72.95 45.33 5 1 PHE A 149 ? ? -117.07 61.37 6 1 LEU A 182 ? ? -40.57 -16.98 7 1 ALA A 189 ? ? -49.01 -71.40 8 1 SER A 202 ? ? 45.19 95.62 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 202 ? OG ? A SER 202 OG 2 1 Y 1 A PRO 203 ? CG ? A PRO 203 CG 3 1 Y 1 A PRO 203 ? CD ? A PRO 203 CD # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A GLN 204 ? A GLN 204 5 1 Y 1 A ALA 205 ? A ALA 205 6 1 Y 1 A PRO 206 ? A PRO 206 7 1 Y 1 A GLY 207 ? A GLY 207 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #