data_2YW5 # _entry.id 2YW5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YW5 pdb_00002yw5 10.2210/pdb2yw5/pdb RCSB RCSB027209 ? ? WWPDB D_1000027209 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002100040.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2YW5 _pdbx_database_status.recvd_initial_deposition_date 2007-04-19 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Furue, M.' 1 'Suzuki, S.' 2 'Muto, Y.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Terada, T.' 6 'Shirouzu, M.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of the bromodomain from human bromodomain containing protein 3' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Furue, M.' 1 ? primary 'Suzuki, S.' 2 ? primary 'Muto, Y.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Terada, T.' 6 ? primary 'Shirouzu, M.' 7 ? primary 'Yokoyama, S.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Bromodomain-containing protein 3' _entity.formula_weight 15923.322 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 25-155, bromodomain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RING3-like protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWS ASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWS ASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002100040.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 VAL n 1 10 SER n 1 11 ASN n 1 12 PRO n 1 13 SER n 1 14 LYS n 1 15 PRO n 1 16 GLY n 1 17 ARG n 1 18 LYS n 1 19 THR n 1 20 ASN n 1 21 GLN n 1 22 LEU n 1 23 GLN n 1 24 TYR n 1 25 MET n 1 26 GLN n 1 27 ASN n 1 28 VAL n 1 29 VAL n 1 30 VAL n 1 31 LYS n 1 32 THR n 1 33 LEU n 1 34 TRP n 1 35 LYS n 1 36 HIS n 1 37 GLN n 1 38 PHE n 1 39 ALA n 1 40 TRP n 1 41 PRO n 1 42 PHE n 1 43 TYR n 1 44 GLN n 1 45 PRO n 1 46 VAL n 1 47 ASP n 1 48 ALA n 1 49 ILE n 1 50 LYS n 1 51 LEU n 1 52 ASN n 1 53 LEU n 1 54 PRO n 1 55 ASP n 1 56 TYR n 1 57 HIS n 1 58 LYS n 1 59 ILE n 1 60 ILE n 1 61 LYS n 1 62 ASN n 1 63 PRO n 1 64 MET n 1 65 ASP n 1 66 MET n 1 67 GLY n 1 68 THR n 1 69 ILE n 1 70 LYS n 1 71 LYS n 1 72 ARG n 1 73 LEU n 1 74 GLU n 1 75 ASN n 1 76 ASN n 1 77 TYR n 1 78 TYR n 1 79 TRP n 1 80 SER n 1 81 ALA n 1 82 SER n 1 83 GLU n 1 84 CYS n 1 85 MET n 1 86 GLN n 1 87 ASP n 1 88 PHE n 1 89 ASN n 1 90 THR n 1 91 MET n 1 92 PHE n 1 93 THR n 1 94 ASN n 1 95 CYS n 1 96 TYR n 1 97 ILE n 1 98 TYR n 1 99 ASN n 1 100 LYS n 1 101 PRO n 1 102 THR n 1 103 ASP n 1 104 ASP n 1 105 ILE n 1 106 VAL n 1 107 LEU n 1 108 MET n 1 109 ALA n 1 110 GLN n 1 111 ALA n 1 112 LEU n 1 113 GLU n 1 114 LYS n 1 115 ILE n 1 116 PHE n 1 117 LEU n 1 118 GLN n 1 119 LYS n 1 120 VAL n 1 121 ALA n 1 122 GLN n 1 123 MET n 1 124 PRO n 1 125 GLN n 1 126 GLU n 1 127 GLU n 1 128 VAL n 1 129 GLU n 1 130 LEU n 1 131 LEU n 1 132 PRO n 1 133 PRO n 1 134 ALA n 1 135 PRO n 1 136 LYS n 1 137 GLY n 1 138 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'BRD3, KIAA0043, RING3L' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060731-10 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BRD3_HUMAN _struct_ref.pdbx_db_accession Q15059 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQD FNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGK ; _struct_ref.pdbx_align_begin 25 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YW5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 138 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q15059 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 155 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 25 _struct_ref_seq.pdbx_auth_seq_align_end 155 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YW5 GLY A 1 ? UNP Q15059 ? ? 'expression tag' 18 1 1 2YW5 SER A 2 ? UNP Q15059 ? ? 'expression tag' 19 2 1 2YW5 SER A 3 ? UNP Q15059 ? ? 'expression tag' 20 3 1 2YW5 GLY A 4 ? UNP Q15059 ? ? 'expression tag' 21 4 1 2YW5 SER A 5 ? UNP Q15059 ? ? 'expression tag' 22 5 1 2YW5 SER A 6 ? UNP Q15059 ? ? 'expression tag' 23 6 1 2YW5 GLY A 7 ? UNP Q15059 ? ? 'expression tag' 24 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.2mM 13C/15N-PROTEIN; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2YW5 _pdbx_nmr_refine.method 'torsion angle dyanamics, simulated annealing, energy minimization' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2YW5 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_ensemble.entry_id 2YW5 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,structures with the lowest energy,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2YW5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20060702 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9825 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement Amber 9 'Case, D.A.' 6 # _exptl.entry_id 2YW5 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2YW5 _struct.title 'Solution structure of the bromodomain from human bromodomain containing protein 3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YW5 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;bromodomain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 19 ? VAL A 28 ? THR A 36 VAL A 45 1 ? 10 HELX_P HELX_P2 2 VAL A 28 ? HIS A 36 ? VAL A 45 HIS A 53 1 ? 9 HELX_P HELX_P3 3 ALA A 39 ? TYR A 43 ? ALA A 56 TYR A 60 5 ? 5 HELX_P HELX_P4 4 ASP A 55 ? ILE A 60 ? ASP A 72 ILE A 77 1 ? 6 HELX_P HELX_P5 5 ASP A 65 ? GLU A 74 ? ASP A 82 GLU A 91 1 ? 10 HELX_P HELX_P6 6 SER A 80 ? ASN A 99 ? SER A 97 ASN A 116 1 ? 20 HELX_P HELX_P7 7 ASP A 103 ? MET A 123 ? ASP A 120 MET A 140 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2YW5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2YW5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 18 18 GLY GLY A . n A 1 2 SER 2 19 19 SER SER A . n A 1 3 SER 3 20 20 SER SER A . n A 1 4 GLY 4 21 21 GLY GLY A . n A 1 5 SER 5 22 22 SER SER A . n A 1 6 SER 6 23 23 SER SER A . n A 1 7 GLY 7 24 24 GLY GLY A . n A 1 8 GLU 8 25 25 GLU GLU A . n A 1 9 VAL 9 26 26 VAL VAL A . n A 1 10 SER 10 27 27 SER SER A . n A 1 11 ASN 11 28 28 ASN ASN A . n A 1 12 PRO 12 29 29 PRO PRO A . n A 1 13 SER 13 30 30 SER SER A . n A 1 14 LYS 14 31 31 LYS LYS A . n A 1 15 PRO 15 32 32 PRO PRO A . n A 1 16 GLY 16 33 33 GLY GLY A . n A 1 17 ARG 17 34 34 ARG ARG A . n A 1 18 LYS 18 35 35 LYS LYS A . n A 1 19 THR 19 36 36 THR THR A . n A 1 20 ASN 20 37 37 ASN ASN A . n A 1 21 GLN 21 38 38 GLN GLN A . n A 1 22 LEU 22 39 39 LEU LEU A . n A 1 23 GLN 23 40 40 GLN GLN A . n A 1 24 TYR 24 41 41 TYR TYR A . n A 1 25 MET 25 42 42 MET MET A . n A 1 26 GLN 26 43 43 GLN GLN A . n A 1 27 ASN 27 44 44 ASN ASN A . n A 1 28 VAL 28 45 45 VAL VAL A . n A 1 29 VAL 29 46 46 VAL VAL A . n A 1 30 VAL 30 47 47 VAL VAL A . n A 1 31 LYS 31 48 48 LYS LYS A . n A 1 32 THR 32 49 49 THR THR A . n A 1 33 LEU 33 50 50 LEU LEU A . n A 1 34 TRP 34 51 51 TRP TRP A . n A 1 35 LYS 35 52 52 LYS LYS A . n A 1 36 HIS 36 53 53 HIS HIS A . n A 1 37 GLN 37 54 54 GLN GLN A . n A 1 38 PHE 38 55 55 PHE PHE A . n A 1 39 ALA 39 56 56 ALA ALA A . n A 1 40 TRP 40 57 57 TRP TRP A . n A 1 41 PRO 41 58 58 PRO PRO A . n A 1 42 PHE 42 59 59 PHE PHE A . n A 1 43 TYR 43 60 60 TYR TYR A . n A 1 44 GLN 44 61 61 GLN GLN A . n A 1 45 PRO 45 62 62 PRO PRO A . n A 1 46 VAL 46 63 63 VAL VAL A . n A 1 47 ASP 47 64 64 ASP ASP A . n A 1 48 ALA 48 65 65 ALA ALA A . n A 1 49 ILE 49 66 66 ILE ILE A . n A 1 50 LYS 50 67 67 LYS LYS A . n A 1 51 LEU 51 68 68 LEU LEU A . n A 1 52 ASN 52 69 69 ASN ASN A . n A 1 53 LEU 53 70 70 LEU LEU A . n A 1 54 PRO 54 71 71 PRO PRO A . n A 1 55 ASP 55 72 72 ASP ASP A . n A 1 56 TYR 56 73 73 TYR TYR A . n A 1 57 HIS 57 74 74 HIS HIS A . n A 1 58 LYS 58 75 75 LYS LYS A . n A 1 59 ILE 59 76 76 ILE ILE A . n A 1 60 ILE 60 77 77 ILE ILE A . n A 1 61 LYS 61 78 78 LYS LYS A . n A 1 62 ASN 62 79 79 ASN ASN A . n A 1 63 PRO 63 80 80 PRO PRO A . n A 1 64 MET 64 81 81 MET MET A . n A 1 65 ASP 65 82 82 ASP ASP A . n A 1 66 MET 66 83 83 MET MET A . n A 1 67 GLY 67 84 84 GLY GLY A . n A 1 68 THR 68 85 85 THR THR A . n A 1 69 ILE 69 86 86 ILE ILE A . n A 1 70 LYS 70 87 87 LYS LYS A . n A 1 71 LYS 71 88 88 LYS LYS A . n A 1 72 ARG 72 89 89 ARG ARG A . n A 1 73 LEU 73 90 90 LEU LEU A . n A 1 74 GLU 74 91 91 GLU GLU A . n A 1 75 ASN 75 92 92 ASN ASN A . n A 1 76 ASN 76 93 93 ASN ASN A . n A 1 77 TYR 77 94 94 TYR TYR A . n A 1 78 TYR 78 95 95 TYR TYR A . n A 1 79 TRP 79 96 96 TRP TRP A . n A 1 80 SER 80 97 97 SER SER A . n A 1 81 ALA 81 98 98 ALA ALA A . n A 1 82 SER 82 99 99 SER SER A . n A 1 83 GLU 83 100 100 GLU GLU A . n A 1 84 CYS 84 101 101 CYS CYS A . n A 1 85 MET 85 102 102 MET MET A . n A 1 86 GLN 86 103 103 GLN GLN A . n A 1 87 ASP 87 104 104 ASP ASP A . n A 1 88 PHE 88 105 105 PHE PHE A . n A 1 89 ASN 89 106 106 ASN ASN A . n A 1 90 THR 90 107 107 THR THR A . n A 1 91 MET 91 108 108 MET MET A . n A 1 92 PHE 92 109 109 PHE PHE A . n A 1 93 THR 93 110 110 THR THR A . n A 1 94 ASN 94 111 111 ASN ASN A . n A 1 95 CYS 95 112 112 CYS CYS A . n A 1 96 TYR 96 113 113 TYR TYR A . n A 1 97 ILE 97 114 114 ILE ILE A . n A 1 98 TYR 98 115 115 TYR TYR A . n A 1 99 ASN 99 116 116 ASN ASN A . n A 1 100 LYS 100 117 117 LYS LYS A . n A 1 101 PRO 101 118 118 PRO PRO A . n A 1 102 THR 102 119 119 THR THR A . n A 1 103 ASP 103 120 120 ASP ASP A . n A 1 104 ASP 104 121 121 ASP ASP A . n A 1 105 ILE 105 122 122 ILE ILE A . n A 1 106 VAL 106 123 123 VAL VAL A . n A 1 107 LEU 107 124 124 LEU LEU A . n A 1 108 MET 108 125 125 MET MET A . n A 1 109 ALA 109 126 126 ALA ALA A . n A 1 110 GLN 110 127 127 GLN GLN A . n A 1 111 ALA 111 128 128 ALA ALA A . n A 1 112 LEU 112 129 129 LEU LEU A . n A 1 113 GLU 113 130 130 GLU GLU A . n A 1 114 LYS 114 131 131 LYS LYS A . n A 1 115 ILE 115 132 132 ILE ILE A . n A 1 116 PHE 116 133 133 PHE PHE A . n A 1 117 LEU 117 134 134 LEU LEU A . n A 1 118 GLN 118 135 135 GLN GLN A . n A 1 119 LYS 119 136 136 LYS LYS A . n A 1 120 VAL 120 137 137 VAL VAL A . n A 1 121 ALA 121 138 138 ALA ALA A . n A 1 122 GLN 122 139 139 GLN GLN A . n A 1 123 MET 123 140 140 MET MET A . n A 1 124 PRO 124 141 141 PRO PRO A . n A 1 125 GLN 125 142 142 GLN GLN A . n A 1 126 GLU 126 143 143 GLU GLU A . n A 1 127 GLU 127 144 144 GLU GLU A . n A 1 128 VAL 128 145 145 VAL VAL A . n A 1 129 GLU 129 146 146 GLU GLU A . n A 1 130 LEU 130 147 147 LEU LEU A . n A 1 131 LEU 131 148 148 LEU LEU A . n A 1 132 PRO 132 149 149 PRO PRO A . n A 1 133 PRO 133 150 150 PRO PRO A . n A 1 134 ALA 134 151 151 ALA ALA A . n A 1 135 PRO 135 152 152 PRO PRO A . n A 1 136 LYS 136 153 153 LYS LYS A . n A 1 137 GLY 137 154 154 GLY GLY A . n A 1 138 LYS 138 155 155 LYS LYS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-22 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 89 ? ? CZ A ARG 89 ? ? NH1 A ARG 89 ? ? 123.31 120.30 3.01 0.50 N 2 3 NE A ARG 89 ? ? CZ A ARG 89 ? ? NH1 A ARG 89 ? ? 123.44 120.30 3.14 0.50 N 3 4 NE A ARG 34 ? ? CZ A ARG 34 ? ? NH1 A ARG 34 ? ? 123.36 120.30 3.06 0.50 N 4 6 NE A ARG 34 ? ? CZ A ARG 34 ? ? NH1 A ARG 34 ? ? 123.52 120.30 3.22 0.50 N 5 8 NE A ARG 89 ? ? CZ A ARG 89 ? ? NH1 A ARG 89 ? ? 123.56 120.30 3.26 0.50 N 6 14 NE A ARG 34 ? ? CZ A ARG 34 ? ? NH1 A ARG 34 ? ? 123.57 120.30 3.27 0.50 N 7 19 NE A ARG 89 ? ? CZ A ARG 89 ? ? NH1 A ARG 89 ? ? 123.44 120.30 3.14 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 91 ? ? -67.73 1.92 2 2 SER A 20 ? ? -71.67 48.33 3 2 VAL A 45 ? ? -130.64 -50.13 4 2 TYR A 94 ? ? -140.53 -40.71 5 3 VAL A 45 ? ? -136.99 -50.18 6 3 ASN A 93 ? ? 37.24 65.75 7 4 SER A 19 ? ? -74.51 39.24 8 4 VAL A 45 ? ? -127.53 -54.65 9 4 TYR A 94 ? ? -148.25 -38.12 10 5 SER A 19 ? ? -151.19 68.48 11 5 SER A 30 ? ? -141.82 -24.92 12 5 VAL A 45 ? ? -130.28 -53.56 13 5 ASN A 79 ? ? -153.16 81.63 14 5 GLU A 91 ? ? -68.18 3.61 15 5 ASN A 93 ? ? -83.31 37.50 16 6 VAL A 45 ? ? -138.83 -41.08 17 7 VAL A 45 ? ? -133.60 -49.67 18 7 LEU A 70 ? ? -116.10 78.96 19 7 TYR A 94 ? ? -155.54 -34.48 20 8 VAL A 45 ? ? -128.40 -52.18 21 8 LEU A 70 ? ? -113.92 78.24 22 8 ASN A 93 ? ? -99.12 34.20 23 9 SER A 19 ? ? 63.99 -3.74 24 9 VAL A 45 ? ? -131.84 -48.61 25 9 ASN A 93 ? ? -78.34 36.89 26 10 SER A 30 ? ? -156.48 -32.63 27 10 VAL A 45 ? ? -129.20 -51.40 28 10 PRO A 152 ? ? -77.38 36.94 29 11 SER A 19 ? ? -145.91 36.92 30 11 VAL A 26 ? ? -148.46 -27.57 31 11 VAL A 45 ? ? -133.85 -50.66 32 11 ASN A 93 ? ? 34.86 56.72 33 12 VAL A 45 ? ? -127.96 -51.68 34 12 TYR A 94 ? ? -137.09 -33.77 35 13 VAL A 45 ? ? -130.38 -49.83 36 13 ASP A 64 ? ? -69.57 78.77 37 13 ASN A 93 ? ? -105.39 42.54 38 14 VAL A 45 ? ? -132.81 -50.26 39 14 TYR A 94 ? ? -131.24 -37.78 40 15 VAL A 45 ? ? -134.07 -50.26 41 16 VAL A 45 ? ? -133.64 -48.55 42 17 SER A 22 ? ? -54.77 108.64 43 17 VAL A 26 ? ? -141.24 -7.27 44 17 SER A 27 ? ? -142.88 29.26 45 17 PRO A 29 ? ? -79.71 -167.61 46 17 SER A 30 ? ? 49.29 29.29 47 17 VAL A 45 ? ? -135.89 -48.45 48 17 ASP A 64 ? ? -69.87 85.81 49 17 ASN A 93 ? ? -75.94 37.00 50 18 VAL A 45 ? ? -133.03 -53.08 51 18 ASN A 93 ? ? -78.03 44.94 52 19 SER A 30 ? ? -158.24 -13.67 53 19 VAL A 45 ? ? -133.47 -52.72 54 19 LEU A 70 ? ? -113.87 78.36 55 19 TYR A 94 ? ? -140.36 -46.26 56 20 SER A 30 ? ? -156.18 -5.09 57 20 VAL A 45 ? ? -133.15 -52.80 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 19 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 94 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.078 _pdbx_validate_planes.type 'SIDE CHAIN' #