data_2YY3 # _entry.id 2YY3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2YY3 RCSB RCSB027279 WWPDB D_1000027279 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id pho001030026.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2YY3 _pdbx_database_status.recvd_initial_deposition_date 2007-04-27 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ishii, T.' 1 'Bessho, Y.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Crystal Structure of translation elongation factor EF-1 beta from Pyrococcus horikoshii' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ishii, T.' 1 primary 'Bessho, Y.' 2 primary 'Yokoyama, S.' 3 # _cell.entry_id 2YY3 _cell.length_a 50.001 _cell.length_b 77.791 _cell.length_c 114.593 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2YY3 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Elongation factor 1-beta' 10457.496 3 ? ? ? ? 2 water nat water 18.015 69 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'EF-1-beta, aEF-1beta' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)SDFNLVGVIRV(MSE)PTDPDVNLDELEEKLKKVIPEKYGLAKVEREPIAFGLVALKFYVLGRDEEGYSFDEVAE KFEEVENVESAEVETVSRI ; _entity_poly.pdbx_seq_one_letter_code_can ;MSDFNLVGVIRVMPTDPDVNLDELEEKLKKVIPEKYGLAKVEREPIAFGLVALKFYVLGRDEEGYSFDEVAEKFEEVENV ESAEVETVSRI ; _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier pho001030026.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 SER n 1 3 ASP n 1 4 PHE n 1 5 ASN n 1 6 LEU n 1 7 VAL n 1 8 GLY n 1 9 VAL n 1 10 ILE n 1 11 ARG n 1 12 VAL n 1 13 MSE n 1 14 PRO n 1 15 THR n 1 16 ASP n 1 17 PRO n 1 18 ASP n 1 19 VAL n 1 20 ASN n 1 21 LEU n 1 22 ASP n 1 23 GLU n 1 24 LEU n 1 25 GLU n 1 26 GLU n 1 27 LYS n 1 28 LEU n 1 29 LYS n 1 30 LYS n 1 31 VAL n 1 32 ILE n 1 33 PRO n 1 34 GLU n 1 35 LYS n 1 36 TYR n 1 37 GLY n 1 38 LEU n 1 39 ALA n 1 40 LYS n 1 41 VAL n 1 42 GLU n 1 43 ARG n 1 44 GLU n 1 45 PRO n 1 46 ILE n 1 47 ALA n 1 48 PHE n 1 49 GLY n 1 50 LEU n 1 51 VAL n 1 52 ALA n 1 53 LEU n 1 54 LYS n 1 55 PHE n 1 56 TYR n 1 57 VAL n 1 58 LEU n 1 59 GLY n 1 60 ARG n 1 61 ASP n 1 62 GLU n 1 63 GLU n 1 64 GLY n 1 65 TYR n 1 66 SER n 1 67 PHE n 1 68 ASP n 1 69 GLU n 1 70 VAL n 1 71 ALA n 1 72 GLU n 1 73 LYS n 1 74 PHE n 1 75 GLU n 1 76 GLU n 1 77 VAL n 1 78 GLU n 1 79 ASN n 1 80 VAL n 1 81 GLU n 1 82 SER n 1 83 ALA n 1 84 GLU n 1 85 VAL n 1 86 GLU n 1 87 THR n 1 88 VAL n 1 89 SER n 1 90 ARG n 1 91 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pyrococcus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Pyrococcus horikoshii' _entity_src_gen.gene_src_strain OT3 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus horikoshii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 70601 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-CodonPlus(DE3)-RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EF1B_PYRHO _struct_ref.pdbx_db_accession P58748 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSDFNLVGVIRVMPTDPDVNLDELEEKLKKVIPEKYGLAKVEREPIAFGLVALKFYVLGRDEEGYSFDEVAEKFEEVENV ESAEVETVSRI ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2YY3 A 1 ? 91 ? P58748 1 ? 91 ? 1 91 2 1 2YY3 B 1 ? 91 ? P58748 1 ? 91 ? 1 91 3 1 2YY3 C 1 ? 91 ? P58748 1 ? 91 ? 1 91 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2YY3 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.55 _exptl_crystal.density_percent_sol 65.36 _exptl_crystal.description 'the file contains Friedel pairs.' _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.1 _exptl_crystal_grow.pdbx_details '0.1M Tris-HCl, 0.2M Lithium Sulfate, 2M Ammonium Sulfate, pH 7.1, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2007-03-08 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator Si _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97874 1.0 2 0.97904 1.0 3 0.99476 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL44B2' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL44B2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.97874, 0.97904, 0.99476' # _reflns.entry_id 2YY3 _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.50 _reflns.number_obs 32040 _reflns.number_all ? _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.051 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 41.5 _reflns.pdbx_redundancy 7.1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.60 _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.299 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2YY3 _refine.ls_number_reflns_obs 28677 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 330020.20 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 32.18 _refine.ls_d_res_high 2.50 _refine.ls_percent_reflns_obs 96.1 _refine.ls_R_factor_obs 0.236 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.236 _refine.ls_R_factor_R_free 0.285 _refine.ls_R_factor_R_free_error 0.005 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.8 _refine.ls_number_reflns_R_free 2812 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 59.1 _refine.aniso_B[1][1] -7.20 _refine.aniso_B[2][2] 12.68 _refine.aniso_B[3][3] -5.48 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.347946 _refine.solvent_model_param_bsol 47.0065 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'the file contains Friedel pairs.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2YY3 _refine_analyze.Luzzati_coordinate_error_obs 0.38 _refine_analyze.Luzzati_sigma_a_obs 0.42 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.46 _refine_analyze.Luzzati_sigma_a_free 0.54 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2187 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 69 _refine_hist.number_atoms_total 2256 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 32.18 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 24.9 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.85 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.50 _refine_ls_shell.d_res_low 2.66 _refine_ls_shell.number_reflns_R_work 3998 _refine_ls_shell.R_factor_R_work 0.344 _refine_ls_shell.percent_reflns_obs 89.2 _refine_ls_shell.R_factor_R_free 0.399 _refine_ls_shell.R_factor_R_free_error 0.019 _refine_ls_shell.percent_reflns_R_free 9.6 _refine_ls_shell.number_reflns_R_free 423 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 water_rep.param water_rep.top 'X-RAY DIFFRACTION' # _struct.entry_id 2YY3 _struct.title 'Crystal Structure of translation elongation factor EF-1 beta from Pyrococcus horikoshii' _struct.pdbx_descriptor 'Elongation factor 1-beta' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YY3 _struct_keywords.pdbx_keywords TRANSLATION _struct_keywords.text ;Elongation factor, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSLATION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 2 ? F N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 20 ? ILE A 32 ? ASN A 20 ILE A 32 1 ? 13 HELX_P HELX_P2 2 SER A 66 ? VAL A 77 ? SER A 66 VAL A 77 1 ? 12 HELX_P HELX_P3 3 ASN B 20 ? LYS B 29 ? ASN B 20 LYS B 29 1 ? 10 HELX_P HELX_P4 4 SER B 66 ? VAL B 77 ? SER B 66 VAL B 77 1 ? 12 HELX_P HELX_P5 5 LEU C 21 ? LYS C 30 ? LEU C 21 LYS C 30 1 ? 10 HELX_P HELX_P6 6 SER C 66 ? GLU C 75 ? SER C 66 GLU C 75 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A SER 2 N ? ? A MSE 1 A SER 2 1_555 ? ? ? ? ? ? ? 1.338 ? covale2 covale ? ? A VAL 12 C ? ? ? 1_555 A MSE 13 N ? ? A VAL 12 A MSE 13 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A MSE 13 C ? ? ? 1_555 A PRO 14 N ? ? A MSE 13 A PRO 14 1_555 ? ? ? ? ? ? ? 1.350 ? covale4 covale ? ? B MSE 1 C ? ? ? 1_555 B SER 2 N ? ? B MSE 1 B SER 2 1_555 ? ? ? ? ? ? ? 1.331 ? covale5 covale ? ? B VAL 12 C ? ? ? 1_555 B MSE 13 N ? ? B VAL 12 B MSE 13 1_555 ? ? ? ? ? ? ? 1.329 ? covale6 covale ? ? B MSE 13 C ? ? ? 1_555 B PRO 14 N ? ? B MSE 13 B PRO 14 1_555 ? ? ? ? ? ? ? 1.337 ? covale7 covale ? ? C MSE 1 C ? ? ? 1_555 C SER 2 N ? ? C MSE 1 C SER 2 1_555 ? ? ? ? ? ? ? 1.328 ? covale8 covale ? ? C VAL 12 C ? ? ? 1_555 C MSE 13 N ? ? C VAL 12 C MSE 13 1_555 ? ? ? ? ? ? ? 1.327 ? covale9 covale ? ? C MSE 13 C ? ? ? 1_555 C PRO 14 N ? ? C MSE 13 C PRO 14 1_555 ? ? ? ? ? ? ? 1.344 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? C ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 37 ? PRO A 45 ? GLY A 37 PRO A 45 A 2 VAL A 51 ? GLY A 59 ? VAL A 51 GLY A 59 A 3 LEU A 6 ? PRO A 14 ? LEU A 6 PRO A 14 A 4 VAL A 80 ? ARG A 90 ? VAL A 80 ARG A 90 B 1 GLY B 37 ? ALA B 47 ? GLY B 37 ALA B 47 B 2 LEU B 50 ? GLY B 59 ? LEU B 50 GLY B 59 B 3 LEU B 6 ? PRO B 14 ? LEU B 6 PRO B 14 B 4 VAL B 80 ? ARG B 90 ? VAL B 80 ARG B 90 C 1 GLY C 37 ? ALA C 47 ? GLY C 37 ALA C 47 C 2 LEU C 50 ? GLY C 59 ? LEU C 50 GLY C 59 C 3 LEU C 6 ? PRO C 14 ? LEU C 6 PRO C 14 C 4 VAL C 80 ? ARG C 90 ? VAL C 80 ARG C 90 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 37 ? N GLY A 37 O LEU A 58 ? O LEU A 58 A 2 3 O LEU A 53 ? O LEU A 53 N VAL A 12 ? N VAL A 12 A 3 4 N MSE A 13 ? N MSE A 13 O GLU A 81 ? O GLU A 81 B 1 2 N GLU B 42 ? N GLU B 42 O LYS B 54 ? O LYS B 54 B 2 3 O LEU B 53 ? O LEU B 53 N VAL B 12 ? N VAL B 12 B 3 4 N VAL B 9 ? N VAL B 9 O GLU B 86 ? O GLU B 86 C 1 2 N GLY C 37 ? N GLY C 37 O LEU C 58 ? O LEU C 58 C 2 3 O VAL C 57 ? O VAL C 57 N GLY C 8 ? N GLY C 8 C 3 4 N MSE C 13 ? N MSE C 13 O GLU C 81 ? O GLU C 81 # _database_PDB_matrix.entry_id 2YY3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2YY3 _atom_sites.fract_transf_matrix[1][1] 0.020000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012855 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008727 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 MSE 13 13 13 MSE MSE A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 ILE 91 91 91 ILE ILE A . n B 1 1 MSE 1 1 1 MSE MSE B . n B 1 2 SER 2 2 2 SER SER B . n B 1 3 ASP 3 3 3 ASP ASP B . n B 1 4 PHE 4 4 4 PHE PHE B . n B 1 5 ASN 5 5 5 ASN ASN B . n B 1 6 LEU 6 6 6 LEU LEU B . n B 1 7 VAL 7 7 7 VAL VAL B . n B 1 8 GLY 8 8 8 GLY GLY B . n B 1 9 VAL 9 9 9 VAL VAL B . n B 1 10 ILE 10 10 10 ILE ILE B . n B 1 11 ARG 11 11 11 ARG ARG B . n B 1 12 VAL 12 12 12 VAL VAL B . n B 1 13 MSE 13 13 13 MSE MSE B . n B 1 14 PRO 14 14 14 PRO PRO B . n B 1 15 THR 15 15 15 THR THR B . n B 1 16 ASP 16 16 16 ASP ASP B . n B 1 17 PRO 17 17 17 PRO PRO B . n B 1 18 ASP 18 18 18 ASP ASP B . n B 1 19 VAL 19 19 19 VAL VAL B . n B 1 20 ASN 20 20 20 ASN ASN B . n B 1 21 LEU 21 21 21 LEU LEU B . n B 1 22 ASP 22 22 22 ASP ASP B . n B 1 23 GLU 23 23 23 GLU GLU B . n B 1 24 LEU 24 24 24 LEU LEU B . n B 1 25 GLU 25 25 25 GLU GLU B . n B 1 26 GLU 26 26 26 GLU GLU B . n B 1 27 LYS 27 27 27 LYS LYS B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 LYS 29 29 29 LYS LYS B . n B 1 30 LYS 30 30 30 LYS LYS B . n B 1 31 VAL 31 31 31 VAL VAL B . n B 1 32 ILE 32 32 32 ILE ILE B . n B 1 33 PRO 33 33 33 PRO PRO B . n B 1 34 GLU 34 34 34 GLU GLU B . n B 1 35 LYS 35 35 35 LYS LYS B . n B 1 36 TYR 36 36 36 TYR TYR B . n B 1 37 GLY 37 37 37 GLY GLY B . n B 1 38 LEU 38 38 38 LEU LEU B . n B 1 39 ALA 39 39 39 ALA ALA B . n B 1 40 LYS 40 40 40 LYS LYS B . n B 1 41 VAL 41 41 41 VAL VAL B . n B 1 42 GLU 42 42 42 GLU GLU B . n B 1 43 ARG 43 43 43 ARG ARG B . n B 1 44 GLU 44 44 44 GLU GLU B . n B 1 45 PRO 45 45 45 PRO PRO B . n B 1 46 ILE 46 46 46 ILE ILE B . n B 1 47 ALA 47 47 47 ALA ALA B . n B 1 48 PHE 48 48 48 PHE PHE B . n B 1 49 GLY 49 49 49 GLY GLY B . n B 1 50 LEU 50 50 50 LEU LEU B . n B 1 51 VAL 51 51 51 VAL VAL B . n B 1 52 ALA 52 52 52 ALA ALA B . n B 1 53 LEU 53 53 53 LEU LEU B . n B 1 54 LYS 54 54 54 LYS LYS B . n B 1 55 PHE 55 55 55 PHE PHE B . n B 1 56 TYR 56 56 56 TYR TYR B . n B 1 57 VAL 57 57 57 VAL VAL B . n B 1 58 LEU 58 58 58 LEU LEU B . n B 1 59 GLY 59 59 59 GLY GLY B . n B 1 60 ARG 60 60 60 ARG ARG B . n B 1 61 ASP 61 61 61 ASP ASP B . n B 1 62 GLU 62 62 62 GLU GLU B . n B 1 63 GLU 63 63 63 GLU GLU B . n B 1 64 GLY 64 64 64 GLY GLY B . n B 1 65 TYR 65 65 65 TYR TYR B . n B 1 66 SER 66 66 66 SER SER B . n B 1 67 PHE 67 67 67 PHE PHE B . n B 1 68 ASP 68 68 68 ASP ASP B . n B 1 69 GLU 69 69 69 GLU GLU B . n B 1 70 VAL 70 70 70 VAL VAL B . n B 1 71 ALA 71 71 71 ALA ALA B . n B 1 72 GLU 72 72 72 GLU GLU B . n B 1 73 LYS 73 73 73 LYS LYS B . n B 1 74 PHE 74 74 74 PHE PHE B . n B 1 75 GLU 75 75 75 GLU GLU B . n B 1 76 GLU 76 76 76 GLU GLU B . n B 1 77 VAL 77 77 77 VAL VAL B . n B 1 78 GLU 78 78 78 GLU GLU B . n B 1 79 ASN 79 79 79 ASN ASN B . n B 1 80 VAL 80 80 80 VAL VAL B . n B 1 81 GLU 81 81 81 GLU GLU B . n B 1 82 SER 82 82 82 SER SER B . n B 1 83 ALA 83 83 83 ALA ALA B . n B 1 84 GLU 84 84 84 GLU GLU B . n B 1 85 VAL 85 85 85 VAL VAL B . n B 1 86 GLU 86 86 86 GLU GLU B . n B 1 87 THR 87 87 87 THR THR B . n B 1 88 VAL 88 88 88 VAL VAL B . n B 1 89 SER 89 89 89 SER SER B . n B 1 90 ARG 90 90 90 ARG ARG B . n B 1 91 ILE 91 91 91 ILE ILE B . n C 1 1 MSE 1 1 1 MSE MSE C . n C 1 2 SER 2 2 2 SER SER C . n C 1 3 ASP 3 3 3 ASP ASP C . n C 1 4 PHE 4 4 4 PHE PHE C . n C 1 5 ASN 5 5 5 ASN ASN C . n C 1 6 LEU 6 6 6 LEU LEU C . n C 1 7 VAL 7 7 7 VAL VAL C . n C 1 8 GLY 8 8 8 GLY GLY C . n C 1 9 VAL 9 9 9 VAL VAL C . n C 1 10 ILE 10 10 10 ILE ILE C . n C 1 11 ARG 11 11 11 ARG ARG C . n C 1 12 VAL 12 12 12 VAL VAL C . n C 1 13 MSE 13 13 13 MSE MSE C . n C 1 14 PRO 14 14 14 PRO PRO C . n C 1 15 THR 15 15 15 THR THR C . n C 1 16 ASP 16 16 16 ASP ASP C . n C 1 17 PRO 17 17 17 PRO PRO C . n C 1 18 ASP 18 18 18 ASP ASP C . n C 1 19 VAL 19 19 19 VAL VAL C . n C 1 20 ASN 20 20 20 ASN ASN C . n C 1 21 LEU 21 21 21 LEU LEU C . n C 1 22 ASP 22 22 22 ASP ASP C . n C 1 23 GLU 23 23 23 GLU GLU C . n C 1 24 LEU 24 24 24 LEU LEU C . n C 1 25 GLU 25 25 25 GLU GLU C . n C 1 26 GLU 26 26 26 GLU GLU C . n C 1 27 LYS 27 27 27 LYS LYS C . n C 1 28 LEU 28 28 28 LEU LEU C . n C 1 29 LYS 29 29 29 LYS LYS C . n C 1 30 LYS 30 30 30 LYS LYS C . n C 1 31 VAL 31 31 31 VAL VAL C . n C 1 32 ILE 32 32 32 ILE ILE C . n C 1 33 PRO 33 33 33 PRO PRO C . n C 1 34 GLU 34 34 34 GLU GLU C . n C 1 35 LYS 35 35 35 LYS LYS C . n C 1 36 TYR 36 36 36 TYR TYR C . n C 1 37 GLY 37 37 37 GLY GLY C . n C 1 38 LEU 38 38 38 LEU LEU C . n C 1 39 ALA 39 39 39 ALA ALA C . n C 1 40 LYS 40 40 40 LYS LYS C . n C 1 41 VAL 41 41 41 VAL VAL C . n C 1 42 GLU 42 42 42 GLU GLU C . n C 1 43 ARG 43 43 43 ARG ARG C . n C 1 44 GLU 44 44 44 GLU GLU C . n C 1 45 PRO 45 45 45 PRO PRO C . n C 1 46 ILE 46 46 46 ILE ILE C . n C 1 47 ALA 47 47 47 ALA ALA C . n C 1 48 PHE 48 48 48 PHE PHE C . n C 1 49 GLY 49 49 49 GLY GLY C . n C 1 50 LEU 50 50 50 LEU LEU C . n C 1 51 VAL 51 51 51 VAL VAL C . n C 1 52 ALA 52 52 52 ALA ALA C . n C 1 53 LEU 53 53 53 LEU LEU C . n C 1 54 LYS 54 54 54 LYS LYS C . n C 1 55 PHE 55 55 55 PHE PHE C . n C 1 56 TYR 56 56 56 TYR TYR C . n C 1 57 VAL 57 57 57 VAL VAL C . n C 1 58 LEU 58 58 58 LEU LEU C . n C 1 59 GLY 59 59 59 GLY GLY C . n C 1 60 ARG 60 60 60 ARG ARG C . n C 1 61 ASP 61 61 61 ASP ASP C . n C 1 62 GLU 62 62 62 GLU GLU C . n C 1 63 GLU 63 63 63 GLU GLU C . n C 1 64 GLY 64 64 64 GLY GLY C . n C 1 65 TYR 65 65 65 TYR TYR C . n C 1 66 SER 66 66 66 SER SER C . n C 1 67 PHE 67 67 67 PHE PHE C . n C 1 68 ASP 68 68 68 ASP ASP C . n C 1 69 GLU 69 69 69 GLU GLU C . n C 1 70 VAL 70 70 70 VAL VAL C . n C 1 71 ALA 71 71 71 ALA ALA C . n C 1 72 GLU 72 72 72 GLU GLU C . n C 1 73 LYS 73 73 73 LYS LYS C . n C 1 74 PHE 74 74 74 PHE PHE C . n C 1 75 GLU 75 75 75 GLU GLU C . n C 1 76 GLU 76 76 76 GLU GLU C . n C 1 77 VAL 77 77 77 VAL VAL C . n C 1 78 GLU 78 78 78 GLU GLU C . n C 1 79 ASN 79 79 79 ASN ASN C . n C 1 80 VAL 80 80 80 VAL VAL C . n C 1 81 GLU 81 81 81 GLU GLU C . n C 1 82 SER 82 82 82 SER SER C . n C 1 83 ALA 83 83 83 ALA ALA C . n C 1 84 GLU 84 84 84 GLU GLU C . n C 1 85 VAL 85 85 85 VAL VAL C . n C 1 86 GLU 86 86 86 GLU GLU C . n C 1 87 THR 87 87 87 THR THR C . n C 1 88 VAL 88 88 88 VAL VAL C . n C 1 89 SER 89 89 89 SER SER C . n C 1 90 ARG 90 90 90 ARG ARG C . n C 1 91 ILE 91 91 91 ILE ILE C . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 HOH 1 92 2 HOH TIP A . D 2 HOH 2 93 3 HOH TIP A . D 2 HOH 3 94 4 HOH TIP A . D 2 HOH 4 95 5 HOH TIP A . D 2 HOH 5 96 6 HOH TIP A . D 2 HOH 6 97 9 HOH TIP A . D 2 HOH 7 98 15 HOH TIP A . D 2 HOH 8 99 16 HOH TIP A . D 2 HOH 9 100 17 HOH TIP A . D 2 HOH 10 101 22 HOH TIP A . D 2 HOH 11 102 28 HOH TIP A . D 2 HOH 12 103 29 HOH TIP A . D 2 HOH 13 104 30 HOH TIP A . D 2 HOH 14 105 31 HOH TIP A . D 2 HOH 15 106 32 HOH TIP A . D 2 HOH 16 107 33 HOH TIP A . D 2 HOH 17 108 34 HOH TIP A . D 2 HOH 18 109 41 HOH TIP A . D 2 HOH 19 110 42 HOH TIP A . D 2 HOH 20 111 43 HOH TIP A . D 2 HOH 21 112 51 HOH TIP A . D 2 HOH 22 113 53 HOH TIP A . D 2 HOH 23 114 54 HOH TIP A . D 2 HOH 24 115 55 HOH TIP A . D 2 HOH 25 116 56 HOH TIP A . D 2 HOH 26 117 57 HOH TIP A . D 2 HOH 27 118 58 HOH TIP A . D 2 HOH 28 119 60 HOH TIP A . D 2 HOH 29 120 65 HOH TIP A . D 2 HOH 30 121 66 HOH TIP A . D 2 HOH 31 122 68 HOH TIP A . E 2 HOH 1 92 8 HOH TIP B . E 2 HOH 2 93 10 HOH TIP B . E 2 HOH 3 94 18 HOH TIP B . E 2 HOH 4 95 19 HOH TIP B . E 2 HOH 5 96 20 HOH TIP B . E 2 HOH 6 97 21 HOH TIP B . E 2 HOH 7 98 23 HOH TIP B . E 2 HOH 8 99 24 HOH TIP B . E 2 HOH 9 100 25 HOH TIP B . E 2 HOH 10 101 26 HOH TIP B . E 2 HOH 11 102 35 HOH TIP B . E 2 HOH 12 103 36 HOH TIP B . E 2 HOH 13 104 37 HOH TIP B . E 2 HOH 14 105 40 HOH TIP B . E 2 HOH 15 106 44 HOH TIP B . E 2 HOH 16 107 50 HOH TIP B . E 2 HOH 17 108 52 HOH TIP B . E 2 HOH 18 109 59 HOH TIP B . E 2 HOH 19 110 64 HOH TIP B . F 2 HOH 1 92 1 HOH TIP C . F 2 HOH 2 93 7 HOH TIP C . F 2 HOH 3 94 11 HOH TIP C . F 2 HOH 4 95 12 HOH TIP C . F 2 HOH 5 96 13 HOH TIP C . F 2 HOH 6 97 14 HOH TIP C . F 2 HOH 7 98 27 HOH TIP C . F 2 HOH 8 99 38 HOH TIP C . F 2 HOH 9 100 39 HOH TIP C . F 2 HOH 10 101 45 HOH TIP C . F 2 HOH 11 102 46 HOH TIP C . F 2 HOH 12 103 47 HOH TIP C . F 2 HOH 13 104 48 HOH TIP C . F 2 HOH 14 105 49 HOH TIP C . F 2 HOH 15 106 61 HOH TIP C . F 2 HOH 16 107 62 HOH TIP C . F 2 HOH 17 108 63 HOH TIP C . F 2 HOH 18 109 67 HOH TIP C . F 2 HOH 19 110 69 HOH TIP C . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 13 A MSE 13 ? MET SELENOMETHIONINE 3 B MSE 1 B MSE 1 ? MET SELENOMETHIONINE 4 B MSE 13 B MSE 13 ? MET SELENOMETHIONINE 5 C MSE 1 C MSE 1 ? MET SELENOMETHIONINE 6 C MSE 13 C MSE 13 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,D 2 1 B,E 3 1 C,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-30 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Source and taxonomy' 2 2 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data collection' . ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 SOLVE phasing . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? 84.79 -16.10 2 1 ASP A 3 ? ? -95.99 -157.45 3 1 LYS A 40 ? ? -170.40 146.53 4 1 ASN A 79 ? ? 90.35 3.64 5 1 VAL B 19 ? ? -33.52 141.16 6 1 PRO B 33 ? ? -47.55 25.39 7 1 GLU B 34 ? ? 37.32 7.05 8 1 ILE B 46 ? ? -99.32 -69.86 9 1 ALA B 47 ? ? 179.09 149.67 10 1 SER C 2 ? ? 77.07 -64.76 11 1 ASP C 3 ? ? 163.64 -38.16 12 1 ASN C 20 ? ? -50.08 109.69 13 1 ILE C 46 ? ? -90.52 -77.14 14 1 ASN C 79 ? ? 85.34 15.97 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #