data_2Z0S # _entry.id 2Z0S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2Z0S RCSB RCSB027376 WWPDB D_1000027376 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ape001001448.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2Z0S _pdbx_database_status.recvd_initial_deposition_date 2007-05-07 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Murayama, K.' 1 'Kato-Murayama, M.' 2 'Takemoto, C.' 3 'Terada, T.' 4 'Shirouzu, M.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Crystal structure of putative exosome complex RNA-binding protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Murayama, K.' 1 primary 'Kato-Murayama, M.' 2 primary 'Takemoto, C.' 3 primary 'Terada, T.' 4 primary 'Shirouzu, M.' 5 primary 'Yokoyama, S.' 6 # _cell.entry_id 2Z0S _cell.length_a 97.414 _cell.length_b 97.414 _cell.length_c 136.548 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2Z0S _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Probable exosome complex RNA-binding protein 1' _entity.formula_weight 26096.549 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSSERQLAGRIVVPGEPLPEEVEASPPYVIDYKGVKRATVVGLLREKGDGGGRAFVKLKEIYVPQAGDVVIGLIQSVGIM NWFVDINSPYVAVLSVQDFLGRPFNPAVDDMQSLLKVGDYIKAKVVAFDKTRSPLLTVQGEGLGRIVRGKIVEISPAKVP RVIGRKMSMLKTLEEKTECKIFVARNGRIHLECPNEDLEAIAVMAIKIIDEEAYTSGLTKRIIKFIEEERRIREV ; _entity_poly.pdbx_seq_one_letter_code_can ;MSSERQLAGRIVVPGEPLPEEVEASPPYVIDYKGVKRATVVGLLREKGDGGGRAFVKLKEIYVPQAGDVVIGLIQSVGIM NWFVDINSPYVAVLSVQDFLGRPFNPAVDDMQSLLKVGDYIKAKVVAFDKTRSPLLTVQGEGLGRIVRGKIVEISPAKVP RVIGRKMSMLKTLEEKTECKIFVARNGRIHLECPNEDLEAIAVMAIKIIDEEAYTSGLTKRIIKFIEEERRIREV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ape001001448.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 SER n 1 4 GLU n 1 5 ARG n 1 6 GLN n 1 7 LEU n 1 8 ALA n 1 9 GLY n 1 10 ARG n 1 11 ILE n 1 12 VAL n 1 13 VAL n 1 14 PRO n 1 15 GLY n 1 16 GLU n 1 17 PRO n 1 18 LEU n 1 19 PRO n 1 20 GLU n 1 21 GLU n 1 22 VAL n 1 23 GLU n 1 24 ALA n 1 25 SER n 1 26 PRO n 1 27 PRO n 1 28 TYR n 1 29 VAL n 1 30 ILE n 1 31 ASP n 1 32 TYR n 1 33 LYS n 1 34 GLY n 1 35 VAL n 1 36 LYS n 1 37 ARG n 1 38 ALA n 1 39 THR n 1 40 VAL n 1 41 VAL n 1 42 GLY n 1 43 LEU n 1 44 LEU n 1 45 ARG n 1 46 GLU n 1 47 LYS n 1 48 GLY n 1 49 ASP n 1 50 GLY n 1 51 GLY n 1 52 GLY n 1 53 ARG n 1 54 ALA n 1 55 PHE n 1 56 VAL n 1 57 LYS n 1 58 LEU n 1 59 LYS n 1 60 GLU n 1 61 ILE n 1 62 TYR n 1 63 VAL n 1 64 PRO n 1 65 GLN n 1 66 ALA n 1 67 GLY n 1 68 ASP n 1 69 VAL n 1 70 VAL n 1 71 ILE n 1 72 GLY n 1 73 LEU n 1 74 ILE n 1 75 GLN n 1 76 SER n 1 77 VAL n 1 78 GLY n 1 79 ILE n 1 80 MET n 1 81 ASN n 1 82 TRP n 1 83 PHE n 1 84 VAL n 1 85 ASP n 1 86 ILE n 1 87 ASN n 1 88 SER n 1 89 PRO n 1 90 TYR n 1 91 VAL n 1 92 ALA n 1 93 VAL n 1 94 LEU n 1 95 SER n 1 96 VAL n 1 97 GLN n 1 98 ASP n 1 99 PHE n 1 100 LEU n 1 101 GLY n 1 102 ARG n 1 103 PRO n 1 104 PHE n 1 105 ASN n 1 106 PRO n 1 107 ALA n 1 108 VAL n 1 109 ASP n 1 110 ASP n 1 111 MET n 1 112 GLN n 1 113 SER n 1 114 LEU n 1 115 LEU n 1 116 LYS n 1 117 VAL n 1 118 GLY n 1 119 ASP n 1 120 TYR n 1 121 ILE n 1 122 LYS n 1 123 ALA n 1 124 LYS n 1 125 VAL n 1 126 VAL n 1 127 ALA n 1 128 PHE n 1 129 ASP n 1 130 LYS n 1 131 THR n 1 132 ARG n 1 133 SER n 1 134 PRO n 1 135 LEU n 1 136 LEU n 1 137 THR n 1 138 VAL n 1 139 GLN n 1 140 GLY n 1 141 GLU n 1 142 GLY n 1 143 LEU n 1 144 GLY n 1 145 ARG n 1 146 ILE n 1 147 VAL n 1 148 ARG n 1 149 GLY n 1 150 LYS n 1 151 ILE n 1 152 VAL n 1 153 GLU n 1 154 ILE n 1 155 SER n 1 156 PRO n 1 157 ALA n 1 158 LYS n 1 159 VAL n 1 160 PRO n 1 161 ARG n 1 162 VAL n 1 163 ILE n 1 164 GLY n 1 165 ARG n 1 166 LYS n 1 167 MET n 1 168 SER n 1 169 MET n 1 170 LEU n 1 171 LYS n 1 172 THR n 1 173 LEU n 1 174 GLU n 1 175 GLU n 1 176 LYS n 1 177 THR n 1 178 GLU n 1 179 CYS n 1 180 LYS n 1 181 ILE n 1 182 PHE n 1 183 VAL n 1 184 ALA n 1 185 ARG n 1 186 ASN n 1 187 GLY n 1 188 ARG n 1 189 ILE n 1 190 HIS n 1 191 LEU n 1 192 GLU n 1 193 CYS n 1 194 PRO n 1 195 ASN n 1 196 GLU n 1 197 ASP n 1 198 LEU n 1 199 GLU n 1 200 ALA n 1 201 ILE n 1 202 ALA n 1 203 VAL n 1 204 MET n 1 205 ALA n 1 206 ILE n 1 207 LYS n 1 208 ILE n 1 209 ILE n 1 210 ASP n 1 211 GLU n 1 212 GLU n 1 213 ALA n 1 214 TYR n 1 215 THR n 1 216 SER n 1 217 GLY n 1 218 LEU n 1 219 THR n 1 220 LYS n 1 221 ARG n 1 222 ILE n 1 223 ILE n 1 224 LYS n 1 225 PHE n 1 226 ILE n 1 227 GLU n 1 228 GLU n 1 229 GLU n 1 230 ARG n 1 231 ARG n 1 232 ILE n 1 233 ARG n 1 234 GLU n 1 235 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Aeropyrum _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aeropyrum pernix' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 56636 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ECR1_AERPE _struct_ref.pdbx_db_accession Q9YC02 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSSERQLAGRIVVPGEPLPEEVEASPPYVIDYKGVKRATVVGLLREKGDGGGRAFVKLKEIYVPQAGDVVIGLIQSVGIM NWFVDINSPYVAVLSVQDFLGRPFNPAVDDMQSLLKVGDYIKAKVVAFDKTRSPLLTVQGEGLGRIVRGKIVEISPAKVP RVIGRKMSMLKTLEEKTECKIFVARNGRIHLECPNEDLEAIAVMAIKIIDEEAYTSGLTKRIIKFIEEERRIREV ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2Z0S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 235 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9YC02 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 235 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 235 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2Z0S _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.58 _exptl_crystal.density_percent_sol 65.67 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_details '10% Ethanol, 1.5M NaCl, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RIGAKU JUPITER 210' _diffrn_detector.pdbx_collection_date 2006-10-17 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL26B2' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL26B2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.00 # _reflns.entry_id 2Z0S _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F -3.0 _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 3.20 _reflns.number_obs 6813 _reflns.number_all ? _reflns.percent_possible_obs 100 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.081 _reflns.pdbx_netI_over_sigmaI 43.6 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 19.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 3.20 _reflns_shell.d_res_low 3.31 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2Z0S _refine.ls_number_reflns_obs 6777 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 2398620.47 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 48.71 _refine.ls_d_res_high 3.20 _refine.ls_percent_reflns_obs 100.0 _refine.ls_R_factor_obs 0.277 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.277 _refine.ls_R_factor_R_free 0.331 _refine.ls_R_factor_R_free_error 0.012 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.9 _refine.ls_number_reflns_R_free 739 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 89.6 _refine.aniso_B[1][1] -24.73 _refine.aniso_B[2][2] -24.73 _refine.aniso_B[3][3] 49.46 _refine.aniso_B[1][2] 5.18 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.327704 _refine.solvent_model_param_bsol 53.4381 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 2BA0' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2Z0S _refine_analyze.Luzzati_coordinate_error_obs 0.44 _refine_analyze.Luzzati_sigma_a_obs 0.56 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.59 _refine_analyze.Luzzati_sigma_a_free 0.71 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1377 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1377 _refine_hist.d_res_high 3.20 _refine_hist.d_res_low 48.71 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.5 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 24.2 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.89 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 12.91 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 20.46 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 12.72 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 19.04 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 3.20 _refine_ls_shell.d_res_low 3.40 _refine_ls_shell.number_reflns_R_work 969 _refine_ls_shell.R_factor_R_work 0.371 _refine_ls_shell.percent_reflns_obs 100.0 _refine_ls_shell.R_factor_R_free 0.398 _refine_ls_shell.R_factor_R_free_error 0.035 _refine_ls_shell.percent_reflns_R_free 11.7 _refine_ls_shell.number_reflns_R_free 128 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_xplor_file.serial_no 1 _pdbx_xplor_file.param_file protein_rep.param _pdbx_xplor_file.topol_file protein.top _pdbx_xplor_file.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2Z0S _struct.title 'Crystal structure of putative exosome complex RNA-binding protein' _struct.pdbx_descriptor 'Probable exosome complex RNA-binding protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2Z0S _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text ;alpha/beta protein, Cytoplasm, Exosome, RNA BINDING PROTEIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 96 ? GLY A 101 ? VAL A 96 GLY A 101 1 ? 6 HELX_P HELX_P2 2 SER A 155 ? ILE A 163 ? SER A 155 ILE A 163 5 ? 9 HELX_P HELX_P3 3 GLY A 164 ? LYS A 166 ? GLY A 164 LYS A 166 5 ? 3 HELX_P HELX_P4 4 MET A 167 ? GLU A 178 ? MET A 167 GLU A 178 1 ? 12 HELX_P HELX_P5 5 ASN A 195 ? GLU A 212 ? ASN A 195 GLU A 212 1 ? 18 HELX_P HELX_P6 6 LEU A 218 ? ARG A 233 ? LEU A 218 ARG A 233 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 144 ? ARG A 145 ? GLY A 144 ARG A 145 A 2 TYR A 120 ? PHE A 128 ? TYR A 120 PHE A 128 A 3 PRO A 134 ? THR A 137 ? PRO A 134 THR A 137 A 4 ALA A 92 ? SER A 95 ? ALA A 92 SER A 95 A 5 ASN A 81 ? ASP A 85 ? ASN A 81 ASP A 85 A 6 VAL A 70 ? VAL A 77 ? VAL A 70 VAL A 77 A 7 TYR A 120 ? PHE A 128 ? TYR A 120 PHE A 128 B 1 LYS A 150 ? GLU A 153 ? LYS A 150 GLU A 153 B 2 ARG A 188 ? GLU A 192 ? ARG A 188 GLU A 192 B 3 LYS A 180 ? ALA A 184 ? LYS A 180 ALA A 184 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLY A 144 ? O GLY A 144 N LYS A 122 ? N LYS A 122 A 2 3 N ALA A 127 ? N ALA A 127 O LEU A 135 ? O LEU A 135 A 3 4 O LEU A 136 ? O LEU A 136 N VAL A 93 ? N VAL A 93 A 4 5 O LEU A 94 ? O LEU A 94 N TRP A 82 ? N TRP A 82 A 5 6 O ASP A 85 ? O ASP A 85 N LEU A 73 ? N LEU A 73 A 6 7 N VAL A 70 ? N VAL A 70 O ALA A 123 ? O ALA A 123 B 1 2 N LYS A 150 ? N LYS A 150 O LEU A 191 ? O LEU A 191 B 2 3 O GLU A 192 ? O GLU A 192 N LYS A 180 ? N LYS A 180 # _database_PDB_matrix.entry_id 2Z0S _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2Z0S _atom_sites.fract_transf_matrix[1][1] 0.010265 _atom_sites.fract_transf_matrix[1][2] 0.005927 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011854 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007323 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 ARG 5 5 ? ? ? A . n A 1 6 GLN 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 ALA 8 8 ? ? ? A . n A 1 9 GLY 9 9 ? ? ? A . n A 1 10 ARG 10 10 ? ? ? A . n A 1 11 ILE 11 11 ? ? ? A . n A 1 12 VAL 12 12 ? ? ? A . n A 1 13 VAL 13 13 ? ? ? A . n A 1 14 PRO 14 14 ? ? ? A . n A 1 15 GLY 15 15 ? ? ? A . n A 1 16 GLU 16 16 ? ? ? A . n A 1 17 PRO 17 17 ? ? ? A . n A 1 18 LEU 18 18 ? ? ? A . n A 1 19 PRO 19 19 ? ? ? A . n A 1 20 GLU 20 20 ? ? ? A . n A 1 21 GLU 21 21 ? ? ? A . n A 1 22 VAL 22 22 ? ? ? A . n A 1 23 GLU 23 23 ? ? ? A . n A 1 24 ALA 24 24 ? ? ? A . n A 1 25 SER 25 25 ? ? ? A . n A 1 26 PRO 26 26 ? ? ? A . n A 1 27 PRO 27 27 ? ? ? A . n A 1 28 TYR 28 28 ? ? ? A . n A 1 29 VAL 29 29 ? ? ? A . n A 1 30 ILE 30 30 ? ? ? A . n A 1 31 ASP 31 31 ? ? ? A . n A 1 32 TYR 32 32 ? ? ? A . n A 1 33 LYS 33 33 ? ? ? A . n A 1 34 GLY 34 34 ? ? ? A . n A 1 35 VAL 35 35 ? ? ? A . n A 1 36 LYS 36 36 ? ? ? A . n A 1 37 ARG 37 37 ? ? ? A . n A 1 38 ALA 38 38 ? ? ? A . n A 1 39 THR 39 39 ? ? ? A . n A 1 40 VAL 40 40 ? ? ? A . n A 1 41 VAL 41 41 ? ? ? A . n A 1 42 GLY 42 42 ? ? ? A . n A 1 43 LEU 43 43 ? ? ? A . n A 1 44 LEU 44 44 ? ? ? A . n A 1 45 ARG 45 45 ? ? ? A . n A 1 46 GLU 46 46 ? ? ? A . n A 1 47 LYS 47 47 ? ? ? A . n A 1 48 GLY 48 48 ? ? ? A . n A 1 49 ASP 49 49 ? ? ? A . n A 1 50 GLY 50 50 ? ? ? A . n A 1 51 GLY 51 51 ? ? ? A . n A 1 52 GLY 52 52 ? ? ? A . n A 1 53 ARG 53 53 ? ? ? A . n A 1 54 ALA 54 54 ? ? ? A . n A 1 55 PHE 55 55 ? ? ? A . n A 1 56 VAL 56 56 ? ? ? A . n A 1 57 LYS 57 57 ? ? ? A . n A 1 58 LEU 58 58 ? ? ? A . n A 1 59 LYS 59 59 ? ? ? A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 TRP 82 82 82 TRP TRP A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 MET 167 167 167 MET MET A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 MET 169 169 169 MET MET A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 THR 172 172 172 THR THR A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 CYS 179 179 179 CYS CYS A . n A 1 180 LYS 180 180 180 LYS LYS A . n A 1 181 ILE 181 181 181 ILE ILE A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 ASN 186 186 186 ASN ASN A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 ILE 189 189 189 ILE ILE A . n A 1 190 HIS 190 190 190 HIS HIS A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 CYS 193 193 193 CYS CYS A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 ASN 195 195 195 ASN ASN A . n A 1 196 GLU 196 196 196 GLU GLU A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 ALA 200 200 200 ALA ALA A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 MET 204 204 204 MET MET A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 ILE 206 206 206 ILE ILE A . n A 1 207 LYS 207 207 207 LYS LYS A . n A 1 208 ILE 208 208 208 ILE ILE A . n A 1 209 ILE 209 209 209 ILE ILE A . n A 1 210 ASP 210 210 210 ASP ASP A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 TYR 214 214 214 TYR TYR A . n A 1 215 THR 215 215 215 THR THR A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 THR 219 219 219 THR THR A . n A 1 220 LYS 220 220 220 LYS LYS A . n A 1 221 ARG 221 221 221 ARG ARG A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 ILE 223 223 223 ILE ILE A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 PHE 225 225 225 PHE PHE A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 GLU 227 227 227 GLU GLU A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 GLU 229 229 229 GLU GLU A . n A 1 230 ARG 230 230 230 ARG ARG A . n A 1 231 ARG 231 231 231 ARG ARG A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 ARG 233 233 233 ARG ARG A . n A 1 234 GLU 234 234 234 GLU GLU A . n A 1 235 VAL 235 235 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-11-13 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data reduction' . ? 2 HKL-2000 'data scaling' . ? 3 MOLREP phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 66 ? ? -25.52 91.49 2 1 PRO A 106 ? ? -36.98 -27.84 3 1 ALA A 107 ? ? -77.89 -102.19 4 1 ASP A 109 ? ? 164.34 -76.68 5 1 ASP A 110 ? ? -22.31 132.36 6 1 MET A 111 ? ? -169.91 84.76 7 1 SER A 113 ? ? -161.57 20.71 8 1 ALA A 127 ? ? -177.27 -177.38 9 1 LYS A 130 ? ? -58.86 23.59 10 1 ARG A 132 ? ? 82.63 0.67 11 1 GLU A 141 ? ? -27.12 -78.39 12 1 VAL A 147 ? ? -79.02 -98.58 13 1 ARG A 185 ? ? -49.15 -9.16 14 1 ASN A 195 ? ? -171.34 122.77 15 1 SER A 216 ? ? -30.40 -82.40 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A ARG 5 ? A ARG 5 6 1 Y 1 A GLN 6 ? A GLN 6 7 1 Y 1 A LEU 7 ? A LEU 7 8 1 Y 1 A ALA 8 ? A ALA 8 9 1 Y 1 A GLY 9 ? A GLY 9 10 1 Y 1 A ARG 10 ? A ARG 10 11 1 Y 1 A ILE 11 ? A ILE 11 12 1 Y 1 A VAL 12 ? A VAL 12 13 1 Y 1 A VAL 13 ? A VAL 13 14 1 Y 1 A PRO 14 ? A PRO 14 15 1 Y 1 A GLY 15 ? A GLY 15 16 1 Y 1 A GLU 16 ? A GLU 16 17 1 Y 1 A PRO 17 ? A PRO 17 18 1 Y 1 A LEU 18 ? A LEU 18 19 1 Y 1 A PRO 19 ? A PRO 19 20 1 Y 1 A GLU 20 ? A GLU 20 21 1 Y 1 A GLU 21 ? A GLU 21 22 1 Y 1 A VAL 22 ? A VAL 22 23 1 Y 1 A GLU 23 ? A GLU 23 24 1 Y 1 A ALA 24 ? A ALA 24 25 1 Y 1 A SER 25 ? A SER 25 26 1 Y 1 A PRO 26 ? A PRO 26 27 1 Y 1 A PRO 27 ? A PRO 27 28 1 Y 1 A TYR 28 ? A TYR 28 29 1 Y 1 A VAL 29 ? A VAL 29 30 1 Y 1 A ILE 30 ? A ILE 30 31 1 Y 1 A ASP 31 ? A ASP 31 32 1 Y 1 A TYR 32 ? A TYR 32 33 1 Y 1 A LYS 33 ? A LYS 33 34 1 Y 1 A GLY 34 ? A GLY 34 35 1 Y 1 A VAL 35 ? A VAL 35 36 1 Y 1 A LYS 36 ? A LYS 36 37 1 Y 1 A ARG 37 ? A ARG 37 38 1 Y 1 A ALA 38 ? A ALA 38 39 1 Y 1 A THR 39 ? A THR 39 40 1 Y 1 A VAL 40 ? A VAL 40 41 1 Y 1 A VAL 41 ? A VAL 41 42 1 Y 1 A GLY 42 ? A GLY 42 43 1 Y 1 A LEU 43 ? A LEU 43 44 1 Y 1 A LEU 44 ? A LEU 44 45 1 Y 1 A ARG 45 ? A ARG 45 46 1 Y 1 A GLU 46 ? A GLU 46 47 1 Y 1 A LYS 47 ? A LYS 47 48 1 Y 1 A GLY 48 ? A GLY 48 49 1 Y 1 A ASP 49 ? A ASP 49 50 1 Y 1 A GLY 50 ? A GLY 50 51 1 Y 1 A GLY 51 ? A GLY 51 52 1 Y 1 A GLY 52 ? A GLY 52 53 1 Y 1 A ARG 53 ? A ARG 53 54 1 Y 1 A ALA 54 ? A ALA 54 55 1 Y 1 A PHE 55 ? A PHE 55 56 1 Y 1 A VAL 56 ? A VAL 56 57 1 Y 1 A LYS 57 ? A LYS 57 58 1 Y 1 A LEU 58 ? A LEU 58 59 1 Y 1 A LYS 59 ? A LYS 59 60 1 Y 1 A VAL 235 ? A VAL 235 #