data_2Z3S # _entry.id 2Z3S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.323 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2Z3S RCSB RCSB027484 WWPDB D_1000027484 BMRB 15299 # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 15299 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2Z3S _pdbx_database_status.recvd_initial_deposition_date 2007-06-06 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pimentel, C.' 1 ;M'Barrek, S. ; 2 'Visan, V.' 3 'Grissmer, S.' 4 'Sabatier, J.M.' 5 'Darbon, H.' 6 'Fajloun, Z.' 7 # _citation.id primary _citation.title ;Chemical synthesis and 1H-NMR 3D structure determination of AgTx2-MTX chimera, a new potential blocker for Kv1.2 channel, derived from MTX and AgTx2 scorpion toxins. ; _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 17 _citation.page_first 107 _citation.page_last 118 _citation.year 2008 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18042681 _citation.pdbx_database_id_DOI 10.1110/ps.073122908 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pimentel, C.' 1 ? primary ;M'Barek, S. ; 2 ? primary 'Visan, V.' 3 ? primary 'Grissmer, S.' 4 ? primary 'Sampieri, F.' 5 ? primary 'Sabatier, J.M.' 6 ? primary 'Darbon, H.' 7 ? primary 'Fajloun, Z.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description AgTx2-MTX _entity.formula_weight 4107.848 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GVPINVSCTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC _entity_poly.pdbx_seq_one_letter_code_can GVPINVSCTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 VAL n 1 3 PRO n 1 4 ILE n 1 5 ASN n 1 6 VAL n 1 7 SER n 1 8 CYS n 1 9 THR n 1 10 GLY n 1 11 SER n 1 12 LYS n 1 13 ASP n 1 14 CYS n 1 15 TYR n 1 16 ALA n 1 17 PRO n 1 18 CYS n 1 19 ARG n 1 20 LYS n 1 21 GLN n 1 22 THR n 1 23 GLY n 1 24 CYS n 1 25 PRO n 1 26 ASN n 1 27 ALA n 1 28 LYS n 1 29 CYS n 1 30 ILE n 1 31 ASN n 1 32 LYS n 1 33 SER n 1 34 CYS n 1 35 LYS n 1 36 CYS n 1 37 TYR n 1 38 GLY n 1 39 CYS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'Solid-Phase Synthesis' # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2Z3S _struct_ref.pdbx_db_accession 2Z3S _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2Z3S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 39 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2Z3S _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 39 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 39 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 DQF-COSY 1 2 1 '2D TOCSY' 1 3 1 '2D NOESY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 290 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 3 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 1MM _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2Z3S _pdbx_nmr_refine.method 'Molecular dynamics based simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2Z3S _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2Z3S _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? ? 1 collection XwinNMR 2.1 ? 2 'structure solution' ARIA 1.2 ? 3 # _exptl.entry_id 2Z3S _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2Z3S _struct.title 'NMR structure of AgTx2-MTX' _struct.pdbx_descriptor AgTx2-MTX _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2Z3S _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'toxin, Inhibitory Cystine Knot, Chimera, Maurotoxin, Agitoxin' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 10 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 23 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 10 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 23 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 8 A CYS 29 1_555 ? ? ? ? ? ? ? 2.028 ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 14 A CYS 34 1_555 ? ? ? ? ? ? ? 2.028 ? disulf3 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 18 A CYS 36 1_555 ? ? ? ? ? ? ? 2.033 ? disulf4 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 24 A CYS 39 1_555 ? ? ? ? ? ? ? 2.034 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 5 ? VAL A 6 ? ASN A 5 VAL A 6 A 2 SER A 33 ? TYR A 37 ? SER A 33 TYR A 37 A 3 ASN A 26 ? ILE A 30 ? ASN A 26 ILE A 30 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 6 ? N VAL A 6 O CYS A 34 ? O CYS A 34 A 2 3 O LYS A 35 ? O LYS A 35 N LYS A 28 ? N LYS A 28 # _database_PDB_matrix.entry_id 2Z3S _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2Z3S _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 CYS 39 39 39 CYS CYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-22 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 3 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_nmr_software.name' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HB A ILE 4 ? ? HB2 A CYS 36 ? ? 1.13 2 5 HB A ILE 4 ? ? HB2 A CYS 36 ? ? 1.32 3 13 HZ2 A LYS 35 ? ? HH A TYR 37 ? ? 1.24 4 16 HB3 A LYS 35 ? ? HE1 A TYR 37 ? ? 1.30 5 16 O A VAL 6 ? ? H A CYS 34 ? ? 1.60 6 18 HD11 A ILE 30 ? ? HZ3 A LYS 35 ? ? 1.31 7 19 HB3 A LYS 35 ? ? HE1 A TYR 37 ? ? 1.12 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 3 ? ? -83.36 36.47 2 1 ILE A 4 ? ? -108.79 66.55 3 1 CYS A 8 ? ? -86.90 31.53 4 1 GLN A 21 ? ? -90.97 -62.81 5 2 SER A 7 ? ? -54.08 173.74 6 2 THR A 9 ? ? -87.16 -79.20 7 2 GLN A 21 ? ? -90.47 -63.25 8 3 PRO A 3 ? ? -97.50 44.81 9 3 ASN A 5 ? ? -93.28 54.41 10 3 CYS A 8 ? ? -85.36 38.85 11 3 ASN A 31 ? ? -40.93 97.94 12 4 SER A 7 ? ? -61.87 -175.94 13 4 THR A 9 ? ? -86.83 -85.67 14 5 CYS A 8 ? ? -80.19 33.39 15 5 GLN A 21 ? ? -91.20 -66.85 16 6 PRO A 3 ? ? -27.87 115.45 17 6 CYS A 8 ? ? -98.19 38.00 18 7 PRO A 3 ? ? -91.56 55.52 19 7 CYS A 8 ? ? -90.97 35.30 20 8 PRO A 3 ? ? -79.37 49.18 21 8 CYS A 8 ? ? -90.53 42.98 22 8 ASN A 26 ? ? -113.60 78.57 23 9 ASN A 5 ? ? -91.55 54.78 24 9 ASN A 31 ? ? -67.13 70.56 25 9 LYS A 32 ? ? 174.88 -33.52 26 10 THR A 9 ? ? -87.66 -83.86 27 10 ASN A 26 ? ? -102.87 78.65 28 10 ASN A 31 ? ? -42.81 97.86 29 11 CYS A 8 ? ? -116.51 63.06 30 11 ASN A 31 ? ? -28.34 -57.56 31 12 THR A 9 ? ? -91.02 -76.49 32 12 ASN A 31 ? ? -46.85 96.20 33 13 PRO A 3 ? ? -30.79 110.52 34 13 ASN A 5 ? ? -92.94 54.14 35 13 CYS A 8 ? ? -95.27 38.84 36 14 CYS A 8 ? ? -93.55 44.08 37 14 THR A 9 ? ? -88.11 -74.17 38 14 ASN A 31 ? ? -20.21 -58.82 39 15 CYS A 8 ? ? -86.31 34.57 40 15 ASN A 31 ? ? -38.45 94.14 41 16 CYS A 8 ? ? -103.08 50.82 42 17 CYS A 8 ? ? -86.75 34.22 43 17 GLN A 21 ? ? -90.69 -72.71 44 17 ASN A 31 ? ? -38.82 91.98 45 18 ASN A 31 ? ? -37.03 96.49 46 19 CYS A 8 ? ? -89.84 32.71 47 20 PRO A 3 ? ? -91.71 43.60 48 20 THR A 9 ? ? -87.69 -73.64 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 3 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 37 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.054 _pdbx_validate_planes.type 'SIDE CHAIN' #