data_2Z9A # _entry.id 2Z9A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2Z9A RCSB RCSB027682 WWPDB D_1000027682 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2qyp . unspecified PDB 2R0R . unspecified PDB 2R1Q . unspecified PDB 2RB3 . unspecified # _pdbx_database_status.entry_id 2Z9A _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-09-18 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rossmann, M.' 1 'Saenger, W.' 2 'Maier, T.' 3 # _citation.id primary _citation.title 'Crystal structures of human saposins C and d: implications for lipid recognition and membrane interactions.' _citation.journal_abbrev Structure _citation.journal_volume 16 _citation.page_first 809 _citation.page_last 817 _citation.year 2008 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18462685 _citation.pdbx_database_id_DOI 10.1016/j.str.2008.02.016 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Rossmann, M.' 1 primary 'Schultz-Heienbrok, R.' 2 primary 'Behlke, J.' 3 primary 'Remmel, N.' 4 primary 'Alings, C.' 5 primary 'Sandhoff, K.' 6 primary 'Saenger, W.' 7 primary 'Maier, T.' 8 # _cell.length_a 48.990 _cell.length_b 48.990 _cell.length_c 155.570 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 2Z9A _cell.pdbx_unique_axis ? _cell.Z_PDB 16 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.entry_id 2Z9A _symmetry.Int_Tables_number 92 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Proactivator polypeptide' 10149.628 2 ? ? ? ? 2 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 3 water nat water 18.015 29 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;YVSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLC SRHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;YVSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLC SRHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 VAL n 1 3 SER n 1 4 ASP n 1 5 VAL n 1 6 TYR n 1 7 CYS n 1 8 GLU n 1 9 VAL n 1 10 CYS n 1 11 GLU n 1 12 PHE n 1 13 LEU n 1 14 VAL n 1 15 LYS n 1 16 GLU n 1 17 VAL n 1 18 THR n 1 19 LYS n 1 20 LEU n 1 21 ILE n 1 22 ASP n 1 23 ASN n 1 24 ASN n 1 25 LYS n 1 26 THR n 1 27 GLU n 1 28 LYS n 1 29 GLU n 1 30 ILE n 1 31 LEU n 1 32 ASP n 1 33 ALA n 1 34 PHE n 1 35 ASP n 1 36 LYS n 1 37 MET n 1 38 CYS n 1 39 SER n 1 40 LYS n 1 41 LEU n 1 42 PRO n 1 43 LYS n 1 44 SER n 1 45 LEU n 1 46 SER n 1 47 GLU n 1 48 GLU n 1 49 CYS n 1 50 GLN n 1 51 GLU n 1 52 VAL n 1 53 VAL n 1 54 ASP n 1 55 THR n 1 56 TYR n 1 57 GLY n 1 58 SER n 1 59 SER n 1 60 ILE n 1 61 LEU n 1 62 SER n 1 63 ILE n 1 64 LEU n 1 65 LEU n 1 66 GLU n 1 67 GLU n 1 68 VAL n 1 69 SER n 1 70 PRO n 1 71 GLU n 1 72 LEU n 1 73 VAL n 1 74 CYS n 1 75 SER n 1 76 MET n 1 77 LEU n 1 78 HIS n 1 79 LEU n 1 80 CYS n 1 81 SER n 1 82 ARG n 1 83 HIS n 1 84 HIS n 1 85 HIS n 1 86 HIS n 1 87 HIS n 1 88 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'PSAP, GLBA, SAP1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Pichia pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus Pichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain GS115 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pPIC9K _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SAP_HUMAN _struct_ref.pdbx_db_accession P07602 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCS _struct_ref.pdbx_align_begin 311 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2Z9A A 3 ? 81 ? P07602 311 ? 389 ? 1 79 2 1 2Z9A B 3 ? 81 ? P07602 311 ? 389 ? 1 79 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2Z9A TYR A 1 ? UNP P07602 ? ? 'EXPRESSION TAG' -1 1 1 2Z9A VAL A 2 ? UNP P07602 ? ? 'EXPRESSION TAG' 0 2 1 2Z9A ARG A 82 ? UNP P07602 ? ? 'EXPRESSION TAG' 80 3 1 2Z9A HIS A 83 ? UNP P07602 ? ? 'EXPRESSION TAG' 81 4 1 2Z9A HIS A 84 ? UNP P07602 ? ? 'EXPRESSION TAG' 82 5 1 2Z9A HIS A 85 ? UNP P07602 ? ? 'EXPRESSION TAG' 83 6 1 2Z9A HIS A 86 ? UNP P07602 ? ? 'EXPRESSION TAG' 84 7 1 2Z9A HIS A 87 ? UNP P07602 ? ? 'EXPRESSION TAG' 85 8 1 2Z9A HIS A 88 ? UNP P07602 ? ? 'EXPRESSION TAG' 86 9 2 2Z9A TYR B 1 ? UNP P07602 ? ? 'EXPRESSION TAG' -1 10 2 2Z9A VAL B 2 ? UNP P07602 ? ? 'EXPRESSION TAG' 0 11 2 2Z9A ARG B 82 ? UNP P07602 ? ? 'EXPRESSION TAG' 80 12 2 2Z9A HIS B 83 ? UNP P07602 ? ? 'EXPRESSION TAG' 81 13 2 2Z9A HIS B 84 ? UNP P07602 ? ? 'EXPRESSION TAG' 82 14 2 2Z9A HIS B 85 ? UNP P07602 ? ? 'EXPRESSION TAG' 83 15 2 2Z9A HIS B 86 ? UNP P07602 ? ? 'EXPRESSION TAG' 84 16 2 2Z9A HIS B 87 ? UNP P07602 ? ? 'EXPRESSION TAG' 85 17 2 2Z9A HIS B 88 ? UNP P07602 ? ? 'EXPRESSION TAG' 86 18 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 2Z9A _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.30 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 46.50 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 4.0 _exptl_crystal_grow.temp 291 _exptl_crystal_grow.pdbx_details ;20 mM NaAcetate, 240 mM magnesium sulfate, 41% (v/v) pentaerythriol ethoxylate 15/4, pH 4.0, vapor diffusion, sitting drop, temperature 291K ; _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2004-02-08 _diffrn_detector.details 'toroidal mirrors' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.933 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-2' _diffrn_source.pdbx_wavelength_list 0.933 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-2 # _reflns.entry_id 2Z9A _reflns.d_resolution_high 2.500 _reflns.number_obs 7088 _reflns.pdbx_Rmerge_I_obs 0.094 _reflns.pdbx_netI_over_sigmaI 18.830 _reflns.percent_possible_obs 99.500 _reflns.B_iso_Wilson_estimate 47.985 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 25 _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.60 _reflns_shell.number_measured_obs 10366 _reflns_shell.number_measured_all ? _reflns_shell.number_unique_obs 760 _reflns_shell.Rmerge_I_obs 0.567 _reflns_shell.meanI_over_sigI_obs 6.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 10030 _reflns_shell.percent_possible_all 100.00 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2Z9A _refine.ls_d_res_high 2.500 _refine.ls_d_res_low 25.000 _refine.pdbx_ls_sigma_F ? _refine.ls_percent_reflns_obs 99.680 _refine.ls_number_reflns_obs 7087 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.ls_R_factor_obs 0.240 _refine.ls_R_factor_R_work 0.239 _refine.ls_R_factor_R_free 0.271 _refine.ls_percent_reflns_R_free 4.700 _refine.ls_number_reflns_R_free 335 _refine.B_iso_mean 46.373 _refine.aniso_B[1][1] 2.560 _refine.aniso_B[2][2] 2.560 _refine.aniso_B[3][3] -5.110 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.936 _refine.correlation_coeff_Fo_to_Fc_free 0.913 _refine.pdbx_overall_ESU_R 0.515 _refine.pdbx_overall_ESU_R_Free 0.296 _refine.overall_SU_ML 0.220 _refine.overall_SU_B 9.643 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.400 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_method_to_determine_struct ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 10030 _refine.ls_R_factor_all ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model 'pdb entry 2gtg' _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1212 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 29 _refine_hist.number_atoms_total 1253 _refine_hist.d_res_high 2.500 _refine_hist.d_res_low 25.000 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 1240 0.011 0.022 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1672 1.332 2.021 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 153 4.784 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 48 40.389 27.917 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 251 20.155 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 205 0.089 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 852 0.003 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 548 0.211 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 854 0.301 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 44 0.153 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 31 0.222 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 5 0.202 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 800 0.636 1.500 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1268 1.154 2.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 487 1.682 3.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 404 2.773 4.500 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 2.500 _refine_ls_shell.d_res_low 2.564 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 100.000 _refine_ls_shell.number_reflns_R_work 489 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.245 _refine_ls_shell.R_factor_R_free 0.247 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 18 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 507 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2Z9A _struct.title 'Crystal Structure of Human Saposin C Dimer in Open Conformation' _struct.pdbx_descriptor 'Proactivator polypeptide' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2Z9A _struct_keywords.text ;lipid binding protein, saposin, activator protein, sap, Disease mutation, Gaucher disease, Glycoprotein, GM2-gangliosidosis, Lipid metabolism, Lysosome, Metachromatic leukodystrophy, Sphingolipid metabolism ; _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 5 ? ASP A 22 ? VAL A 3 ASP A 20 1 ? 18 HELX_P HELX_P2 2 ASN A 23 ? ASP A 32 ? ASN A 21 ASP A 30 1 ? 10 HELX_P HELX_P3 3 ALA A 33 ? LYS A 40 ? ALA A 31 LYS A 38 1 ? 8 HELX_P HELX_P4 4 LEU A 45 ? GLY A 57 ? LEU A 43 GLY A 55 1 ? 13 HELX_P HELX_P5 5 SER A 59 ? GLU A 67 ? SER A 57 GLU A 65 1 ? 9 HELX_P HELX_P6 6 SER A 69 ? LEU A 77 ? SER A 67 LEU A 75 1 ? 9 HELX_P HELX_P7 7 ASP B 4 ? ASP B 22 ? ASP B 2 ASP B 20 1 ? 19 HELX_P HELX_P8 8 ASN B 23 ? LYS B 40 ? ASN B 21 LYS B 38 1 ? 18 HELX_P HELX_P9 9 LEU B 45 ? GLY B 57 ? LEU B 43 GLY B 55 1 ? 13 HELX_P HELX_P10 10 SER B 59 ? GLU B 67 ? SER B 57 GLU B 65 1 ? 9 HELX_P HELX_P11 11 SER B 69 ? LEU B 77 ? SER B 67 LEU B 75 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 80 SG ? ? A CYS 5 A CYS 78 1_555 ? ? ? ? ? ? ? 2.045 ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 74 SG ? ? A CYS 8 A CYS 72 1_555 ? ? ? ? ? ? ? 2.046 ? disulf3 disulf ? ? A CYS 38 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 36 A CYS 47 1_555 ? ? ? ? ? ? ? 2.056 ? disulf4 disulf ? ? B CYS 7 SG ? ? ? 1_555 B CYS 80 SG ? ? B CYS 5 B CYS 78 1_555 ? ? ? ? ? ? ? 2.049 ? disulf5 disulf ? ? B CYS 10 SG ? ? ? 1_555 B CYS 74 SG ? ? B CYS 8 B CYS 72 1_555 ? ? ? ? ? ? ? 2.033 ? disulf6 disulf ? ? B CYS 38 SG ? ? ? 1_555 B CYS 49 SG ? ? B CYS 36 B CYS 47 1_555 ? ? ? ? ? ? ? 2.051 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE GOL B 87' AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE GOL A 87' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 LYS B 15 ? LYS B 13 . ? 1_555 ? 2 AC1 3 HOH F . ? HOH B 96 . ? 1_555 ? 3 AC1 3 HOH F . ? HOH B 103 . ? 1_555 ? 4 AC2 2 HOH E . ? HOH A 93 . ? 1_555 ? 5 AC2 2 HOH E . ? HOH A 94 . ? 1_555 ? # _atom_sites.entry_id 2Z9A _atom_sites.fract_transf_matrix[1][1] 0.020412 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020412 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006428 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 -1 ? ? ? A . n A 1 2 VAL 2 0 ? ? ? A . n A 1 3 SER 3 1 ? ? ? A . n A 1 4 ASP 4 2 2 ASP ASP A . n A 1 5 VAL 5 3 3 VAL VAL A . n A 1 6 TYR 6 4 4 TYR TYR A . n A 1 7 CYS 7 5 5 CYS CYS A . n A 1 8 GLU 8 6 6 GLU GLU A . n A 1 9 VAL 9 7 7 VAL VAL A . n A 1 10 CYS 10 8 8 CYS CYS A . n A 1 11 GLU 11 9 9 GLU GLU A . n A 1 12 PHE 12 10 10 PHE PHE A . n A 1 13 LEU 13 11 11 LEU LEU A . n A 1 14 VAL 14 12 12 VAL VAL A . n A 1 15 LYS 15 13 13 LYS LYS A . n A 1 16 GLU 16 14 14 GLU GLU A . n A 1 17 VAL 17 15 15 VAL VAL A . n A 1 18 THR 18 16 16 THR THR A . n A 1 19 LYS 19 17 17 LYS LYS A . n A 1 20 LEU 20 18 18 LEU LEU A . n A 1 21 ILE 21 19 19 ILE ILE A . n A 1 22 ASP 22 20 20 ASP ASP A . n A 1 23 ASN 23 21 21 ASN ASN A . n A 1 24 ASN 24 22 22 ASN ASN A . n A 1 25 LYS 25 23 23 LYS LYS A . n A 1 26 THR 26 24 24 THR THR A . n A 1 27 GLU 27 25 25 GLU GLU A . n A 1 28 LYS 28 26 26 LYS LYS A . n A 1 29 GLU 29 27 27 GLU GLU A . n A 1 30 ILE 30 28 28 ILE ILE A . n A 1 31 LEU 31 29 29 LEU LEU A . n A 1 32 ASP 32 30 30 ASP ASP A . n A 1 33 ALA 33 31 31 ALA ALA A . n A 1 34 PHE 34 32 32 PHE PHE A . n A 1 35 ASP 35 33 33 ASP ASP A . n A 1 36 LYS 36 34 34 LYS LYS A . n A 1 37 MET 37 35 35 MET MET A . n A 1 38 CYS 38 36 36 CYS CYS A . n A 1 39 SER 39 37 37 SER SER A . n A 1 40 LYS 40 38 38 LYS LYS A . n A 1 41 LEU 41 39 39 LEU LEU A . n A 1 42 PRO 42 40 40 PRO PRO A . n A 1 43 LYS 43 41 41 LYS LYS A . n A 1 44 SER 44 42 42 SER SER A . n A 1 45 LEU 45 43 43 LEU LEU A . n A 1 46 SER 46 44 44 SER SER A . n A 1 47 GLU 47 45 45 GLU GLU A . n A 1 48 GLU 48 46 46 GLU GLU A . n A 1 49 CYS 49 47 47 CYS CYS A . n A 1 50 GLN 50 48 48 GLN GLN A . n A 1 51 GLU 51 49 49 GLU GLU A . n A 1 52 VAL 52 50 50 VAL VAL A . n A 1 53 VAL 53 51 51 VAL VAL A . n A 1 54 ASP 54 52 52 ASP ASP A . n A 1 55 THR 55 53 53 THR THR A . n A 1 56 TYR 56 54 54 TYR TYR A . n A 1 57 GLY 57 55 55 GLY GLY A . n A 1 58 SER 58 56 56 SER SER A . n A 1 59 SER 59 57 57 SER SER A . n A 1 60 ILE 60 58 58 ILE ILE A . n A 1 61 LEU 61 59 59 LEU LEU A . n A 1 62 SER 62 60 60 SER SER A . n A 1 63 ILE 63 61 61 ILE ILE A . n A 1 64 LEU 64 62 62 LEU LEU A . n A 1 65 LEU 65 63 63 LEU LEU A . n A 1 66 GLU 66 64 64 GLU GLU A . n A 1 67 GLU 67 65 65 GLU GLU A . n A 1 68 VAL 68 66 66 VAL VAL A . n A 1 69 SER 69 67 67 SER SER A . n A 1 70 PRO 70 68 68 PRO PRO A . n A 1 71 GLU 71 69 69 GLU GLU A . n A 1 72 LEU 72 70 70 LEU LEU A . n A 1 73 VAL 73 71 71 VAL VAL A . n A 1 74 CYS 74 72 72 CYS CYS A . n A 1 75 SER 75 73 73 SER SER A . n A 1 76 MET 76 74 74 MET MET A . n A 1 77 LEU 77 75 75 LEU LEU A . n A 1 78 HIS 78 76 76 HIS HIS A . n A 1 79 LEU 79 77 77 LEU LEU A . n A 1 80 CYS 80 78 78 CYS CYS A . n A 1 81 SER 81 79 ? ? ? A . n A 1 82 ARG 82 80 ? ? ? A . n A 1 83 HIS 83 81 ? ? ? A . n A 1 84 HIS 84 82 ? ? ? A . n A 1 85 HIS 85 83 ? ? ? A . n A 1 86 HIS 86 84 ? ? ? A . n A 1 87 HIS 87 85 ? ? ? A . n A 1 88 HIS 88 86 ? ? ? A . n B 1 1 TYR 1 -1 ? ? ? B . n B 1 2 VAL 2 0 ? ? ? B . n B 1 3 SER 3 1 ? ? ? B . n B 1 4 ASP 4 2 2 ASP ASP B . n B 1 5 VAL 5 3 3 VAL VAL B . n B 1 6 TYR 6 4 4 TYR TYR B . n B 1 7 CYS 7 5 5 CYS CYS B . n B 1 8 GLU 8 6 6 GLU GLU B . n B 1 9 VAL 9 7 7 VAL VAL B . n B 1 10 CYS 10 8 8 CYS CYS B . n B 1 11 GLU 11 9 9 GLU GLU B . n B 1 12 PHE 12 10 10 PHE PHE B . n B 1 13 LEU 13 11 11 LEU LEU B . n B 1 14 VAL 14 12 12 VAL VAL B . n B 1 15 LYS 15 13 13 LYS LYS B . n B 1 16 GLU 16 14 14 GLU GLU B . n B 1 17 VAL 17 15 15 VAL VAL B . n B 1 18 THR 18 16 16 THR THR B . n B 1 19 LYS 19 17 17 LYS LYS B . n B 1 20 LEU 20 18 18 LEU LEU B . n B 1 21 ILE 21 19 19 ILE ILE B . n B 1 22 ASP 22 20 20 ASP ASP B . n B 1 23 ASN 23 21 21 ASN ASN B . n B 1 24 ASN 24 22 22 ASN ASN B . n B 1 25 LYS 25 23 23 LYS LYS B . n B 1 26 THR 26 24 24 THR THR B . n B 1 27 GLU 27 25 25 GLU GLU B . n B 1 28 LYS 28 26 26 LYS LYS B . n B 1 29 GLU 29 27 27 GLU GLU B . n B 1 30 ILE 30 28 28 ILE ILE B . n B 1 31 LEU 31 29 29 LEU LEU B . n B 1 32 ASP 32 30 30 ASP ASP B . n B 1 33 ALA 33 31 31 ALA ALA B . n B 1 34 PHE 34 32 32 PHE PHE B . n B 1 35 ASP 35 33 33 ASP ASP B . n B 1 36 LYS 36 34 34 LYS LYS B . n B 1 37 MET 37 35 35 MET MET B . n B 1 38 CYS 38 36 36 CYS CYS B . n B 1 39 SER 39 37 37 SER SER B . n B 1 40 LYS 40 38 38 LYS LYS B . n B 1 41 LEU 41 39 39 LEU LEU B . n B 1 42 PRO 42 40 40 PRO PRO B . n B 1 43 LYS 43 41 41 LYS LYS B . n B 1 44 SER 44 42 42 SER SER B . n B 1 45 LEU 45 43 43 LEU LEU B . n B 1 46 SER 46 44 44 SER SER B . n B 1 47 GLU 47 45 45 GLU GLU B . n B 1 48 GLU 48 46 46 GLU GLU B . n B 1 49 CYS 49 47 47 CYS CYS B . n B 1 50 GLN 50 48 48 GLN GLN B . n B 1 51 GLU 51 49 49 GLU GLU B . n B 1 52 VAL 52 50 50 VAL VAL B . n B 1 53 VAL 53 51 51 VAL VAL B . n B 1 54 ASP 54 52 52 ASP ASP B . n B 1 55 THR 55 53 53 THR THR B . n B 1 56 TYR 56 54 54 TYR TYR B . n B 1 57 GLY 57 55 55 GLY GLY B . n B 1 58 SER 58 56 56 SER SER B . n B 1 59 SER 59 57 57 SER SER B . n B 1 60 ILE 60 58 58 ILE ILE B . n B 1 61 LEU 61 59 59 LEU LEU B . n B 1 62 SER 62 60 60 SER SER B . n B 1 63 ILE 63 61 61 ILE ILE B . n B 1 64 LEU 64 62 62 LEU LEU B . n B 1 65 LEU 65 63 63 LEU LEU B . n B 1 66 GLU 66 64 64 GLU GLU B . n B 1 67 GLU 67 65 65 GLU GLU B . n B 1 68 VAL 68 66 66 VAL VAL B . n B 1 69 SER 69 67 67 SER SER B . n B 1 70 PRO 70 68 68 PRO PRO B . n B 1 71 GLU 71 69 69 GLU GLU B . n B 1 72 LEU 72 70 70 LEU LEU B . n B 1 73 VAL 73 71 71 VAL VAL B . n B 1 74 CYS 74 72 72 CYS CYS B . n B 1 75 SER 75 73 73 SER SER B . n B 1 76 MET 76 74 74 MET MET B . n B 1 77 LEU 77 75 75 LEU LEU B . n B 1 78 HIS 78 76 76 HIS HIS B . n B 1 79 LEU 79 77 77 LEU LEU B . n B 1 80 CYS 80 78 78 CYS CYS B . n B 1 81 SER 81 79 79 SER SER B . n B 1 82 ARG 82 80 ? ? ? B . n B 1 83 HIS 83 81 ? ? ? B . n B 1 84 HIS 84 82 ? ? ? B . n B 1 85 HIS 85 83 ? ? ? B . n B 1 86 HIS 86 84 ? ? ? B . n B 1 87 HIS 87 85 ? ? ? B . n B 1 88 HIS 88 86 ? ? ? B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_prop.biol_id 1 _pdbx_struct_assembly_prop.type 'ABSA (A^2)' _pdbx_struct_assembly_prop.value 4340 _pdbx_struct_assembly_prop.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-29 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Non-polymer description' 2 2 'Structure model' 'Version format compliance' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal XSCALE . ? package 'Wolfgang Kabsch' ? 'data scaling' http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/xscale_program.html ? ? 1 REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 2 PDB_EXTRACT 3.000 'July 2, 2007' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 3 ADSC Quantum ? ? ? ? 'data collection' ? ? ? 4 XDS . ? ? ? ? 'data reduction' ? ? ? 5 MOLREP . ? ? ? ? phasing ? ? ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 3 ? ? -144.51 -14.40 2 1 HIS A 76 ? ? 75.73 30.78 3 1 LYS B 38 ? ? -67.58 1.97 4 1 THR B 53 ? ? -130.59 -42.30 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A TYR -1 ? A TYR 1 2 1 Y 1 A VAL 0 ? A VAL 2 3 1 Y 1 A SER 1 ? A SER 3 4 1 Y 1 A SER 79 ? A SER 81 5 1 Y 1 A ARG 80 ? A ARG 82 6 1 Y 1 A HIS 81 ? A HIS 83 7 1 Y 1 A HIS 82 ? A HIS 84 8 1 Y 1 A HIS 83 ? A HIS 85 9 1 Y 1 A HIS 84 ? A HIS 86 10 1 Y 1 A HIS 85 ? A HIS 87 11 1 Y 1 A HIS 86 ? A HIS 88 12 1 Y 1 B TYR -1 ? B TYR 1 13 1 Y 1 B VAL 0 ? B VAL 2 14 1 Y 1 B SER 1 ? B SER 3 15 1 Y 1 B ARG 80 ? B ARG 82 16 1 Y 1 B HIS 81 ? B HIS 83 17 1 Y 1 B HIS 82 ? B HIS 84 18 1 Y 1 B HIS 83 ? B HIS 85 19 1 Y 1 B HIS 84 ? B HIS 86 20 1 Y 1 B HIS 85 ? B HIS 87 21 1 Y 1 B HIS 86 ? B HIS 88 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 GOL 1 87 3 GOL GOL A . D 2 GOL 1 87 1 GOL GOL B . E 3 HOH 1 88 2 HOH HOH A . E 3 HOH 2 89 4 HOH HOH A . E 3 HOH 3 90 6 HOH HOH A . E 3 HOH 4 91 10 HOH HOH A . E 3 HOH 5 92 12 HOH HOH A . E 3 HOH 6 93 13 HOH HOH A . E 3 HOH 7 94 15 HOH HOH A . E 3 HOH 8 95 17 HOH HOH A . E 3 HOH 9 96 18 HOH HOH A . E 3 HOH 10 97 20 HOH HOH A . E 3 HOH 11 98 21 HOH HOH A . E 3 HOH 12 99 27 HOH HOH A . E 3 HOH 13 100 28 HOH HOH A . F 3 HOH 1 88 1 HOH HOH B . F 3 HOH 2 89 3 HOH HOH B . F 3 HOH 3 90 5 HOH HOH B . F 3 HOH 4 91 7 HOH HOH B . F 3 HOH 5 92 8 HOH HOH B . F 3 HOH 6 93 9 HOH HOH B . F 3 HOH 7 94 11 HOH HOH B . F 3 HOH 8 95 14 HOH HOH B . F 3 HOH 9 96 16 HOH HOH B . F 3 HOH 10 97 19 HOH HOH B . F 3 HOH 11 98 22 HOH HOH B . F 3 HOH 12 99 23 HOH HOH B . F 3 HOH 13 100 24 HOH HOH B . F 3 HOH 14 101 25 HOH HOH B . F 3 HOH 15 102 26 HOH HOH B . F 3 HOH 16 103 29 HOH HOH B . #