data_2ZXZ # _entry.id 2ZXZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2ZXZ RCSB RCSB028566 WWPDB D_1000028566 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1FBY '1FBY contains the human RXR alpha ligand binding domain bound to 9-cis retinoic acid' unspecified PDB 1MVC '1MVC contains the same protein complexed with BMS 649' unspecified PDB 1MV9 '1MV9 contains the same protein complexed with DHA (Docosa Hexaenoic Acid)' unspecified PDB 2ZY0 . unspecified # _pdbx_database_status.entry_id 2ZXZ _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2009-01-09 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sato, Y.' 1 'Antony, P.' 2 'Rochel, N.' 3 'Moras, D.' 4 'Structural Genomics Consortium for Research on Gene Expression (SGCGES)' 5 # _citation.id primary _citation.title 'Silicon analogues of the RXR-selective retinoid agonist SR11237 (BMS649): chemistry and biology' _citation.journal_abbrev Chemmedchem _citation.journal_volume 4 _citation.page_first 1143 _citation.page_last 1152 _citation.year 2009 _citation.journal_id_ASTM ? _citation.country DE _citation.journal_id_ISSN 1860-7179 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19496083 _citation.pdbx_database_id_DOI 10.1002/cmdc.200900090 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lippert, W.P.' 1 primary 'Burschka, C.' 2 primary 'Gotz, K.' 3 primary 'Kaupp, M.' 4 primary 'Ivanova, D.' 5 primary 'Gaudon, C.' 6 primary 'Sato, Y.' 7 primary 'Antony, P.' 8 primary 'Rochel, N.' 9 primary 'Moras, D.' 10 primary 'Gronemeyer, H.' 11 primary 'Tacke, R.' 12 # _cell.length_a 64.079 _cell.length_b 64.079 _cell.length_c 110.389 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 2ZXZ _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.entry_id 2ZXZ _symmetry.Int_Tables_number 96 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Retinoic acid receptor RXR-alpha' 26856.039 1 ? ? 'Ligand Binding Domain' ? 2 polymer syn 'GRIP1 from Nuclear receptor coactivator 2' 1579.866 1 ? ? ? ? 3 non-polymer syn '4-[2-(1,1,3,3-tetramethyl-2,3-dihydro-1H-inden-5-yl)-1,3-dioxolan-2-yl]benzoic acid' 366.450 1 ? ? ? ? 4 water nat water 18.015 21 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Retinoid X receptor alpha, Nuclear receptor subfamily 2 group B member 1' 2 'NCoA-2, Transcriptional intermediary factor 2, hTIF2' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;TSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLR AGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKG LSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT ; ;TSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLR AGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKG LSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT ; A ? 2 'polypeptide(L)' no no KHKILHRLLQDSS KHKILHRLLQDSS B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 SER n 1 3 SER n 1 4 ALA n 1 5 ASN n 1 6 GLU n 1 7 ASP n 1 8 MET n 1 9 PRO n 1 10 VAL n 1 11 GLU n 1 12 ARG n 1 13 ILE n 1 14 LEU n 1 15 GLU n 1 16 ALA n 1 17 GLU n 1 18 LEU n 1 19 ALA n 1 20 VAL n 1 21 GLU n 1 22 PRO n 1 23 LYS n 1 24 THR n 1 25 GLU n 1 26 THR n 1 27 TYR n 1 28 VAL n 1 29 GLU n 1 30 ALA n 1 31 ASN n 1 32 MET n 1 33 GLY n 1 34 LEU n 1 35 ASN n 1 36 PRO n 1 37 SER n 1 38 SER n 1 39 PRO n 1 40 ASN n 1 41 ASP n 1 42 PRO n 1 43 VAL n 1 44 THR n 1 45 ASN n 1 46 ILE n 1 47 CYS n 1 48 GLN n 1 49 ALA n 1 50 ALA n 1 51 ASP n 1 52 LYS n 1 53 GLN n 1 54 LEU n 1 55 PHE n 1 56 THR n 1 57 LEU n 1 58 VAL n 1 59 GLU n 1 60 TRP n 1 61 ALA n 1 62 LYS n 1 63 ARG n 1 64 ILE n 1 65 PRO n 1 66 HIS n 1 67 PHE n 1 68 SER n 1 69 GLU n 1 70 LEU n 1 71 PRO n 1 72 LEU n 1 73 ASP n 1 74 ASP n 1 75 GLN n 1 76 VAL n 1 77 ILE n 1 78 LEU n 1 79 LEU n 1 80 ARG n 1 81 ALA n 1 82 GLY n 1 83 TRP n 1 84 ASN n 1 85 GLU n 1 86 LEU n 1 87 LEU n 1 88 ILE n 1 89 ALA n 1 90 SER n 1 91 PHE n 1 92 SER n 1 93 HIS n 1 94 ARG n 1 95 SER n 1 96 ILE n 1 97 ALA n 1 98 VAL n 1 99 LYS n 1 100 ASP n 1 101 GLY n 1 102 ILE n 1 103 LEU n 1 104 LEU n 1 105 ALA n 1 106 THR n 1 107 GLY n 1 108 LEU n 1 109 HIS n 1 110 VAL n 1 111 HIS n 1 112 ARG n 1 113 ASN n 1 114 SER n 1 115 ALA n 1 116 HIS n 1 117 SER n 1 118 ALA n 1 119 GLY n 1 120 VAL n 1 121 GLY n 1 122 ALA n 1 123 ILE n 1 124 PHE n 1 125 ASP n 1 126 ARG n 1 127 VAL n 1 128 LEU n 1 129 THR n 1 130 GLU n 1 131 LEU n 1 132 VAL n 1 133 SER n 1 134 LYS n 1 135 MET n 1 136 ARG n 1 137 ASP n 1 138 MET n 1 139 GLN n 1 140 MET n 1 141 ASP n 1 142 LYS n 1 143 THR n 1 144 GLU n 1 145 LEU n 1 146 GLY n 1 147 CYS n 1 148 LEU n 1 149 ARG n 1 150 ALA n 1 151 ILE n 1 152 VAL n 1 153 LEU n 1 154 PHE n 1 155 ASN n 1 156 PRO n 1 157 ASP n 1 158 SER n 1 159 LYS n 1 160 GLY n 1 161 LEU n 1 162 SER n 1 163 ASN n 1 164 PRO n 1 165 ALA n 1 166 GLU n 1 167 VAL n 1 168 GLU n 1 169 ALA n 1 170 LEU n 1 171 ARG n 1 172 GLU n 1 173 LYS n 1 174 VAL n 1 175 TYR n 1 176 ALA n 1 177 SER n 1 178 LEU n 1 179 GLU n 1 180 ALA n 1 181 TYR n 1 182 CYS n 1 183 LYS n 1 184 HIS n 1 185 LYS n 1 186 TYR n 1 187 PRO n 1 188 GLU n 1 189 GLN n 1 190 PRO n 1 191 GLY n 1 192 ARG n 1 193 PHE n 1 194 ALA n 1 195 LYS n 1 196 LEU n 1 197 LEU n 1 198 LEU n 1 199 ARG n 1 200 LEU n 1 201 PRO n 1 202 ALA n 1 203 LEU n 1 204 ARG n 1 205 SER n 1 206 ILE n 1 207 GLY n 1 208 LEU n 1 209 LYS n 1 210 CYS n 1 211 LEU n 1 212 GLU n 1 213 HIS n 1 214 LEU n 1 215 PHE n 1 216 PHE n 1 217 PHE n 1 218 LYS n 1 219 LEU n 1 220 ILE n 1 221 GLY n 1 222 ASP n 1 223 THR n 1 224 PRO n 1 225 ILE n 1 226 ASP n 1 227 THR n 1 228 PHE n 1 229 LEU n 1 230 MET n 1 231 GLU n 1 232 MET n 1 233 LEU n 1 234 GLU n 1 235 ALA n 1 236 PRO n 1 237 HIS n 1 238 GLN n 1 239 MET n 1 240 THR n 2 1 LYS n 2 2 HIS n 2 3 LYS n 2 4 ILE n 2 5 LEU n 2 6 HIS n 2 7 ARG n 2 8 LEU n 2 9 LEU n 2 10 GLN n 2 11 ASP n 2 12 SER n 2 13 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'This sequence occurs naturally in humans.' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP RXRA_HUMAN P19793 1 ;TSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLR AGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKG LSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT ; 223 ? 2 UNP NCOA2_HUMAN Q15596 2 KHKILHRLLQDSS 686 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2ZXZ A 1 ? 240 ? P19793 223 ? 462 ? 223 462 2 2 2ZXZ B 1 ? 13 ? Q15596 686 ? 698 ? 471 483 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 P26 non-polymer . '4-[2-(1,1,3,3-tetramethyl-2,3-dihydro-1H-inden-5-yl)-1,3-dioxolan-2-yl]benzoic acid' ? 'C23 H26 O4' 366.450 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 2ZXZ _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.density_Matthews 1.99 _exptl_crystal.density_diffrn ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_percent_sol 38.27 _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '10mM Tris-HCl, 250mM NaCl, 5mM DTT, 50mM calcium acetate, 18% PEG3350, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 290K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2007-10-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si(311) or Si(111)' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID29 # _reflns.entry_id 2ZXZ _reflns.d_resolution_high 3.000 _reflns.d_resolution_low 50.000 _reflns.number_obs 5032 _reflns.pdbx_Rmerge_I_obs 0.102 _reflns.pdbx_netI_over_sigmaI 33.776 _reflns.pdbx_chi_squared 1.619 _reflns.pdbx_redundancy 12.300 _reflns.percent_possible_obs 99.900 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all 5032 _reflns.pdbx_Rsym_value 0.102 _reflns.B_iso_Wilson_estimate 57.611 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 3.00 _reflns_shell.d_res_low 3.11 _reflns_shell.number_measured_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_unique_obs ? _reflns_shell.Rmerge_I_obs 0.333 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 1.014 _reflns_shell.pdbx_redundancy 12.60 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 481 _reflns_shell.percent_possible_all 100.00 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2ZXZ _refine.ls_d_res_high 3.000 _refine.ls_d_res_low 10.000 _refine.pdbx_ls_sigma_F ? _refine.ls_percent_reflns_obs 100.000 _refine.ls_number_reflns_obs 4831 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.ls_R_factor_obs 0.210 _refine.ls_R_factor_R_work 0.206 _refine.ls_R_factor_R_free 0.278 _refine.ls_percent_reflns_R_free 4.700 _refine.ls_number_reflns_R_free 226 _refine.B_iso_mean 41.876 _refine.aniso_B[1][1] 0.660 _refine.aniso_B[2][2] 0.660 _refine.aniso_B[3][3] -1.320 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.926 _refine.correlation_coeff_Fo_to_Fc_free 0.870 _refine.pdbx_overall_ESU_R_Free 0.529 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_method_to_determine_struct ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.B_iso_max 65.75 _refine.B_iso_min 13.70 _refine.occupancy_max 1.00 _refine.occupancy_min 0.00 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_all 0.210 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model 'PDB ENTRY 1MZN' _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model Isotropic _refine.details ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1778 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 1826 _refine_hist.d_res_high 3.000 _refine_hist.d_res_low 10.000 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 1819 0.006 0.022 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2469 1.023 2.002 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 221 3.734 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 76 34.847 23.684 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 318 14.445 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 12 22.165 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 284 0.059 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 1342 0.002 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 895 0.172 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 1269 0.291 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 46 0.109 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 41 0.169 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 5 0.107 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1117 0.228 1.500 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1797 0.422 2.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 702 0.399 3.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 672 0.677 4.500 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 3.000 _refine_ls_shell.d_res_low 3.071 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 100.000 _refine_ls_shell.number_reflns_R_work 315 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.296 _refine_ls_shell.R_factor_R_free 0.367 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 17 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 332 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2ZXZ _struct.title 'Crystal structure of the human RXR alpha ligand binding domain bound to a synthetic agonist compound and a coactivator peptide' _struct.pdbx_descriptor 'Retinoic acid receptor RXR-alpha, GRIP1 from Nuclear receptor coactivator 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ZXZ _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;transcription regulation, nuclear receptor, Structural Genomics, Structural Genomics Consortium for Research on Gene Expression, SGCGES, Transcription ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 9 ? ALA A 19 ? PRO A 231 ALA A 241 1 ? 11 HELX_P HELX_P2 2 ASP A 41 ? ILE A 64 ? ASP A 263 ILE A 286 1 ? 24 HELX_P HELX_P3 3 PRO A 71 ? SER A 95 ? PRO A 293 SER A 317 1 ? 25 HELX_P HELX_P4 4 ARG A 112 ? ALA A 118 ? ARG A 334 ALA A 340 1 ? 7 HELX_P HELX_P5 5 VAL A 120 ? LEU A 131 ? VAL A 342 LEU A 353 1 ? 12 HELX_P HELX_P6 6 LEU A 131 ? GLN A 139 ? LEU A 353 GLN A 361 1 ? 9 HELX_P HELX_P7 7 ASP A 141 ? PHE A 154 ? ASP A 363 PHE A 376 1 ? 14 HELX_P HELX_P8 8 ASN A 163 ? TYR A 186 ? ASN A 385 TYR A 408 1 ? 24 HELX_P HELX_P9 9 GLY A 191 ? LEU A 198 ? GLY A 413 LEU A 420 1 ? 8 HELX_P HELX_P10 10 ARG A 199 ? GLY A 221 ? ARG A 421 GLY A 443 1 ? 23 HELX_P HELX_P11 11 ASP A 226 ? LEU A 233 ? ASP A 448 LEU A 455 1 ? 8 HELX_P HELX_P12 12 HIS B 2 ? LEU B 9 ? HIS B 472 LEU B 479 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 235 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 457 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 236 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 458 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.16 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 101 ? LEU A 103 ? GLY A 323 LEU A 325 A 2 HIS A 109 ? HIS A 111 ? HIS A 331 HIS A 333 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 102 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 324 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 110 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 332 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'BINDING SITE FOR RESIDUE P26 A 1' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 ILE A 46 ? ILE A 268 . ? 1_555 ? 2 AC1 11 ALA A 49 ? ALA A 271 . ? 1_555 ? 3 AC1 11 ALA A 50 ? ALA A 272 . ? 1_555 ? 4 AC1 11 GLN A 53 ? GLN A 275 . ? 1_555 ? 5 AC1 11 ASN A 84 ? ASN A 306 . ? 1_555 ? 6 AC1 11 ILE A 88 ? ILE A 310 . ? 1_555 ? 7 AC1 11 PHE A 91 ? PHE A 313 . ? 1_555 ? 8 AC1 11 ARG A 94 ? ARG A 316 . ? 1_555 ? 9 AC1 11 LEU A 104 ? LEU A 326 . ? 1_555 ? 10 AC1 11 ALA A 105 ? ALA A 327 . ? 1_555 ? 11 AC1 11 CYS A 210 ? CYS A 432 . ? 1_555 ? # _atom_sites.entry_id 2ZXZ _atom_sites.fract_transf_matrix[1][1] 0.015606 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015606 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009059 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 223 ? ? ? A . n A 1 2 SER 2 224 ? ? ? A . n A 1 3 SER 3 225 ? ? ? A . n A 1 4 ALA 4 226 ? ? ? A . n A 1 5 ASN 5 227 ? ? ? A . n A 1 6 GLU 6 228 ? ? ? A . n A 1 7 ASP 7 229 229 ASP ASP A . n A 1 8 MET 8 230 230 MET MET A . n A 1 9 PRO 9 231 231 PRO PRO A . n A 1 10 VAL 10 232 232 VAL VAL A . n A 1 11 GLU 11 233 233 GLU GLU A . n A 1 12 ARG 12 234 234 ARG ARG A . n A 1 13 ILE 13 235 235 ILE ILE A . n A 1 14 LEU 14 236 236 LEU LEU A . n A 1 15 GLU 15 237 237 GLU GLU A . n A 1 16 ALA 16 238 238 ALA ALA A . n A 1 17 GLU 17 239 239 GLU GLU A . n A 1 18 LEU 18 240 240 LEU LEU A . n A 1 19 ALA 19 241 241 ALA ALA A . n A 1 20 VAL 20 242 242 VAL VAL A . n A 1 21 GLU 21 243 243 GLU GLU A . n A 1 22 PRO 22 244 244 PRO PRO A . n A 1 23 LYS 23 245 ? ? ? A . n A 1 24 THR 24 246 ? ? ? A . n A 1 25 GLU 25 247 ? ? ? A . n A 1 26 THR 26 248 ? ? ? A . n A 1 27 TYR 27 249 ? ? ? A . n A 1 28 VAL 28 250 ? ? ? A . n A 1 29 GLU 29 251 ? ? ? A . n A 1 30 ALA 30 252 ? ? ? A . n A 1 31 ASN 31 253 ? ? ? A . n A 1 32 MET 32 254 ? ? ? A . n A 1 33 GLY 33 255 ? ? ? A . n A 1 34 LEU 34 256 ? ? ? A . n A 1 35 ASN 35 257 ? ? ? A . n A 1 36 PRO 36 258 ? ? ? A . n A 1 37 SER 37 259 ? ? ? A . n A 1 38 SER 38 260 ? ? ? A . n A 1 39 PRO 39 261 ? ? ? A . n A 1 40 ASN 40 262 262 ASN ASN A . n A 1 41 ASP 41 263 263 ASP ASP A . n A 1 42 PRO 42 264 264 PRO PRO A . n A 1 43 VAL 43 265 265 VAL VAL A . n A 1 44 THR 44 266 266 THR THR A . n A 1 45 ASN 45 267 267 ASN ASN A . n A 1 46 ILE 46 268 268 ILE ILE A . n A 1 47 CYS 47 269 269 CYS CYS A . n A 1 48 GLN 48 270 270 GLN GLN A . n A 1 49 ALA 49 271 271 ALA ALA A . n A 1 50 ALA 50 272 272 ALA ALA A . n A 1 51 ASP 51 273 273 ASP ASP A . n A 1 52 LYS 52 274 274 LYS LYS A . n A 1 53 GLN 53 275 275 GLN GLN A . n A 1 54 LEU 54 276 276 LEU LEU A . n A 1 55 PHE 55 277 277 PHE PHE A . n A 1 56 THR 56 278 278 THR THR A . n A 1 57 LEU 57 279 279 LEU LEU A . n A 1 58 VAL 58 280 280 VAL VAL A . n A 1 59 GLU 59 281 281 GLU GLU A . n A 1 60 TRP 60 282 282 TRP TRP A . n A 1 61 ALA 61 283 283 ALA ALA A . n A 1 62 LYS 62 284 284 LYS LYS A . n A 1 63 ARG 63 285 285 ARG ARG A . n A 1 64 ILE 64 286 286 ILE ILE A . n A 1 65 PRO 65 287 287 PRO PRO A . n A 1 66 HIS 66 288 288 HIS HIS A . n A 1 67 PHE 67 289 289 PHE PHE A . n A 1 68 SER 68 290 290 SER SER A . n A 1 69 GLU 69 291 291 GLU GLU A . n A 1 70 LEU 70 292 292 LEU LEU A . n A 1 71 PRO 71 293 293 PRO PRO A . n A 1 72 LEU 72 294 294 LEU LEU A . n A 1 73 ASP 73 295 295 ASP ASP A . n A 1 74 ASP 74 296 296 ASP ASP A . n A 1 75 GLN 75 297 297 GLN GLN A . n A 1 76 VAL 76 298 298 VAL VAL A . n A 1 77 ILE 77 299 299 ILE ILE A . n A 1 78 LEU 78 300 300 LEU LEU A . n A 1 79 LEU 79 301 301 LEU LEU A . n A 1 80 ARG 80 302 302 ARG ARG A . n A 1 81 ALA 81 303 303 ALA ALA A . n A 1 82 GLY 82 304 304 GLY GLY A . n A 1 83 TRP 83 305 305 TRP TRP A . n A 1 84 ASN 84 306 306 ASN ASN A . n A 1 85 GLU 85 307 307 GLU GLU A . n A 1 86 LEU 86 308 308 LEU LEU A . n A 1 87 LEU 87 309 309 LEU LEU A . n A 1 88 ILE 88 310 310 ILE ILE A . n A 1 89 ALA 89 311 311 ALA ALA A . n A 1 90 SER 90 312 312 SER SER A . n A 1 91 PHE 91 313 313 PHE PHE A . n A 1 92 SER 92 314 314 SER SER A . n A 1 93 HIS 93 315 315 HIS HIS A . n A 1 94 ARG 94 316 316 ARG ARG A . n A 1 95 SER 95 317 317 SER SER A . n A 1 96 ILE 96 318 318 ILE ILE A . n A 1 97 ALA 97 319 319 ALA ALA A . n A 1 98 VAL 98 320 320 VAL VAL A . n A 1 99 LYS 99 321 321 LYS LYS A . n A 1 100 ASP 100 322 322 ASP ASP A . n A 1 101 GLY 101 323 323 GLY GLY A . n A 1 102 ILE 102 324 324 ILE ILE A . n A 1 103 LEU 103 325 325 LEU LEU A . n A 1 104 LEU 104 326 326 LEU LEU A . n A 1 105 ALA 105 327 327 ALA ALA A . n A 1 106 THR 106 328 328 THR THR A . n A 1 107 GLY 107 329 329 GLY GLY A . n A 1 108 LEU 108 330 330 LEU LEU A . n A 1 109 HIS 109 331 331 HIS HIS A . n A 1 110 VAL 110 332 332 VAL VAL A . n A 1 111 HIS 111 333 333 HIS HIS A . n A 1 112 ARG 112 334 334 ARG ARG A . n A 1 113 ASN 113 335 335 ASN ASN A . n A 1 114 SER 114 336 336 SER SER A . n A 1 115 ALA 115 337 337 ALA ALA A . n A 1 116 HIS 116 338 338 HIS HIS A . n A 1 117 SER 117 339 339 SER SER A . n A 1 118 ALA 118 340 340 ALA ALA A . n A 1 119 GLY 119 341 341 GLY GLY A . n A 1 120 VAL 120 342 342 VAL VAL A . n A 1 121 GLY 121 343 343 GLY GLY A . n A 1 122 ALA 122 344 344 ALA ALA A . n A 1 123 ILE 123 345 345 ILE ILE A . n A 1 124 PHE 124 346 346 PHE PHE A . n A 1 125 ASP 125 347 347 ASP ASP A . n A 1 126 ARG 126 348 348 ARG ARG A . n A 1 127 VAL 127 349 349 VAL VAL A . n A 1 128 LEU 128 350 350 LEU LEU A . n A 1 129 THR 129 351 351 THR THR A . n A 1 130 GLU 130 352 352 GLU GLU A . n A 1 131 LEU 131 353 353 LEU LEU A . n A 1 132 VAL 132 354 354 VAL VAL A . n A 1 133 SER 133 355 355 SER SER A . n A 1 134 LYS 134 356 356 LYS LYS A . n A 1 135 MET 135 357 357 MET MET A . n A 1 136 ARG 136 358 358 ARG ARG A . n A 1 137 ASP 137 359 359 ASP ASP A . n A 1 138 MET 138 360 360 MET MET A . n A 1 139 GLN 139 361 361 GLN GLN A . n A 1 140 MET 140 362 362 MET MET A . n A 1 141 ASP 141 363 363 ASP ASP A . n A 1 142 LYS 142 364 364 LYS LYS A . n A 1 143 THR 143 365 365 THR THR A . n A 1 144 GLU 144 366 366 GLU GLU A . n A 1 145 LEU 145 367 367 LEU LEU A . n A 1 146 GLY 146 368 368 GLY GLY A . n A 1 147 CYS 147 369 369 CYS CYS A . n A 1 148 LEU 148 370 370 LEU LEU A . n A 1 149 ARG 149 371 371 ARG ARG A . n A 1 150 ALA 150 372 372 ALA ALA A . n A 1 151 ILE 151 373 373 ILE ILE A . n A 1 152 VAL 152 374 374 VAL VAL A . n A 1 153 LEU 153 375 375 LEU LEU A . n A 1 154 PHE 154 376 376 PHE PHE A . n A 1 155 ASN 155 377 377 ASN ASN A . n A 1 156 PRO 156 378 378 PRO PRO A . n A 1 157 ASP 157 379 379 ASP ASP A . n A 1 158 SER 158 380 380 SER SER A . n A 1 159 LYS 159 381 381 LYS LYS A . n A 1 160 GLY 160 382 382 GLY GLY A . n A 1 161 LEU 161 383 383 LEU LEU A . n A 1 162 SER 162 384 384 SER SER A . n A 1 163 ASN 163 385 385 ASN ASN A . n A 1 164 PRO 164 386 386 PRO PRO A . n A 1 165 ALA 165 387 387 ALA ALA A . n A 1 166 GLU 166 388 388 GLU GLU A . n A 1 167 VAL 167 389 389 VAL VAL A . n A 1 168 GLU 168 390 390 GLU GLU A . n A 1 169 ALA 169 391 391 ALA ALA A . n A 1 170 LEU 170 392 392 LEU LEU A . n A 1 171 ARG 171 393 393 ARG ARG A . n A 1 172 GLU 172 394 394 GLU GLU A . n A 1 173 LYS 173 395 395 LYS LYS A . n A 1 174 VAL 174 396 396 VAL VAL A . n A 1 175 TYR 175 397 397 TYR TYR A . n A 1 176 ALA 176 398 398 ALA ALA A . n A 1 177 SER 177 399 399 SER SER A . n A 1 178 LEU 178 400 400 LEU LEU A . n A 1 179 GLU 179 401 401 GLU GLU A . n A 1 180 ALA 180 402 402 ALA ALA A . n A 1 181 TYR 181 403 403 TYR TYR A . n A 1 182 CYS 182 404 404 CYS CYS A . n A 1 183 LYS 183 405 405 LYS LYS A . n A 1 184 HIS 184 406 406 HIS HIS A . n A 1 185 LYS 185 407 407 LYS LYS A . n A 1 186 TYR 186 408 408 TYR TYR A . n A 1 187 PRO 187 409 409 PRO PRO A . n A 1 188 GLU 188 410 410 GLU GLU A . n A 1 189 GLN 189 411 411 GLN GLN A . n A 1 190 PRO 190 412 412 PRO PRO A . n A 1 191 GLY 191 413 413 GLY GLY A . n A 1 192 ARG 192 414 414 ARG ARG A . n A 1 193 PHE 193 415 415 PHE PHE A . n A 1 194 ALA 194 416 416 ALA ALA A . n A 1 195 LYS 195 417 417 LYS LYS A . n A 1 196 LEU 196 418 418 LEU LEU A . n A 1 197 LEU 197 419 419 LEU LEU A . n A 1 198 LEU 198 420 420 LEU LEU A . n A 1 199 ARG 199 421 421 ARG ARG A . n A 1 200 LEU 200 422 422 LEU LEU A . n A 1 201 PRO 201 423 423 PRO PRO A . n A 1 202 ALA 202 424 424 ALA ALA A . n A 1 203 LEU 203 425 425 LEU LEU A . n A 1 204 ARG 204 426 426 ARG ARG A . n A 1 205 SER 205 427 427 SER SER A . n A 1 206 ILE 206 428 428 ILE ILE A . n A 1 207 GLY 207 429 429 GLY GLY A . n A 1 208 LEU 208 430 430 LEU LEU A . n A 1 209 LYS 209 431 431 LYS LYS A . n A 1 210 CYS 210 432 432 CYS CYS A . n A 1 211 LEU 211 433 433 LEU LEU A . n A 1 212 GLU 212 434 434 GLU GLU A . n A 1 213 HIS 213 435 435 HIS HIS A . n A 1 214 LEU 214 436 436 LEU LEU A . n A 1 215 PHE 215 437 437 PHE PHE A . n A 1 216 PHE 216 438 438 PHE PHE A . n A 1 217 PHE 217 439 439 PHE PHE A . n A 1 218 LYS 218 440 440 LYS LYS A . n A 1 219 LEU 219 441 441 LEU LEU A . n A 1 220 ILE 220 442 442 ILE ILE A . n A 1 221 GLY 221 443 443 GLY GLY A . n A 1 222 ASP 222 444 444 ASP ASP A . n A 1 223 THR 223 445 445 THR THR A . n A 1 224 PRO 224 446 446 PRO PRO A . n A 1 225 ILE 225 447 447 ILE ILE A . n A 1 226 ASP 226 448 448 ASP ASP A . n A 1 227 THR 227 449 449 THR THR A . n A 1 228 PHE 228 450 450 PHE PHE A . n A 1 229 LEU 229 451 451 LEU LEU A . n A 1 230 MET 230 452 452 MET MET A . n A 1 231 GLU 231 453 453 GLU GLU A . n A 1 232 MET 232 454 454 MET MET A . n A 1 233 LEU 233 455 455 LEU LEU A . n A 1 234 GLU 234 456 456 GLU GLU A . n A 1 235 ALA 235 457 457 ALA ALA A . n A 1 236 PRO 236 458 458 PRO PRO A . n A 1 237 HIS 237 459 ? ? ? A . n A 1 238 GLN 238 460 ? ? ? A . n A 1 239 MET 239 461 ? ? ? A . n A 1 240 THR 240 462 ? ? ? A . n B 2 1 LYS 1 471 471 LYS LYS B . n B 2 2 HIS 2 472 472 HIS HIS B . n B 2 3 LYS 3 473 473 LYS LYS B . n B 2 4 ILE 4 474 474 ILE ILE B . n B 2 5 LEU 5 475 475 LEU LEU B . n B 2 6 HIS 6 476 476 HIS HIS B . n B 2 7 ARG 7 477 477 ARG ARG B . n B 2 8 LEU 8 478 478 LEU LEU B . n B 2 9 LEU 9 479 479 LEU LEU B . n B 2 10 GLN 10 480 480 GLN GLN B . n B 2 11 ASP 11 481 481 ASP ASP B . n B 2 12 SER 12 482 ? ? ? B . n B 2 13 SER 13 483 ? ? ? B . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium for Research on Gene Expression' _pdbx_SG_project.initial_of_center SGCGES # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 P26 1 1 1 P26 P26 A . D 4 HOH 1 2 2 HOH HOH A . D 4 HOH 2 3 3 HOH HOH A . D 4 HOH 3 5 5 HOH HOH A . D 4 HOH 4 8 8 HOH HOH A . D 4 HOH 5 12 12 HOH HOH A . D 4 HOH 6 13 13 HOH HOH A . D 4 HOH 7 14 14 HOH HOH A . D 4 HOH 8 15 15 HOH HOH A . D 4 HOH 9 18 18 HOH HOH A . D 4 HOH 10 23 23 HOH HOH A . D 4 HOH 11 24 24 HOH HOH A . D 4 HOH 12 25 25 HOH HOH A . D 4 HOH 13 27 27 HOH HOH A . D 4 HOH 14 28 28 HOH HOH A . D 4 HOH 15 29 29 HOH HOH A . D 4 HOH 16 30 30 HOH HOH A . D 4 HOH 17 31 31 HOH HOH A . D 4 HOH 18 32 32 HOH HOH A . D 4 HOH 19 33 33 HOH HOH A . D 4 HOH 20 463 1 HOH HOH A . E 4 HOH 1 21 21 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_775 -y+2,-x+2,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 128.1580000000 -1.0000000000 0.0000000000 0.0000000000 128.1580000000 0.0000000000 0.0000000000 -1.0000000000 55.1945000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-08-11 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_unobs_or_zero_occ_atoms 2 3 'Structure model' software # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 2 REFMAC 5.2.0019 ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 3 PDB_EXTRACT 3.006 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 4 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 5 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? 6 AMoRE . ? ? ? ? phasing ? ? ? 7 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A GLU 243 ? ? CD A GLU 243 ? ? 1.755 1.515 0.240 0.015 N 2 1 CA A PRO 244 ? ? C A PRO 244 ? ? 1.363 1.524 -0.161 0.020 N 3 1 CG A LYS 321 ? ? CD A LYS 321 ? ? 1.055 1.520 -0.465 0.034 N 4 1 CG A LYS 381 ? ? CD A LYS 381 ? ? 1.038 1.520 -0.482 0.034 N 5 1 CG B LYS 471 ? ? CD B LYS 471 ? ? 1.218 1.520 -0.302 0.034 N 6 1 CD B LYS 471 ? ? CE B LYS 471 ? ? 1.216 1.508 -0.292 0.025 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 288 ? ? 75.12 -3.60 2 1 LEU A 353 ? ? -117.55 -79.42 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 223 ? A THR 1 2 1 Y 1 A SER 224 ? A SER 2 3 1 Y 1 A SER 225 ? A SER 3 4 1 Y 1 A ALA 226 ? A ALA 4 5 1 Y 1 A ASN 227 ? A ASN 5 6 1 Y 1 A GLU 228 ? A GLU 6 7 1 Y 1 A LYS 245 ? A LYS 23 8 1 Y 1 A THR 246 ? A THR 24 9 1 Y 1 A GLU 247 ? A GLU 25 10 1 Y 1 A THR 248 ? A THR 26 11 1 Y 1 A TYR 249 ? A TYR 27 12 1 Y 1 A VAL 250 ? A VAL 28 13 1 Y 1 A GLU 251 ? A GLU 29 14 1 Y 1 A ALA 252 ? A ALA 30 15 1 Y 1 A ASN 253 ? A ASN 31 16 1 Y 1 A MET 254 ? A MET 32 17 1 Y 1 A GLY 255 ? A GLY 33 18 1 Y 1 A LEU 256 ? A LEU 34 19 1 Y 1 A ASN 257 ? A ASN 35 20 1 Y 1 A PRO 258 ? A PRO 36 21 1 Y 1 A SER 259 ? A SER 37 22 1 Y 1 A SER 260 ? A SER 38 23 1 Y 1 A PRO 261 ? A PRO 39 24 1 Y 1 A HIS 459 ? A HIS 237 25 1 Y 1 A GLN 460 ? A GLN 238 26 1 Y 1 A MET 461 ? A MET 239 27 1 Y 1 A THR 462 ? A THR 240 28 1 Y 1 B SER 482 ? B SER 12 29 1 Y 1 B SER 483 ? B SER 13 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 '4-[2-(1,1,3,3-tetramethyl-2,3-dihydro-1H-inden-5-yl)-1,3-dioxolan-2-yl]benzoic acid' P26 4 water HOH #