data_2AX5 # _entry.id 2AX5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2AX5 pdb_00002ax5 10.2210/pdb2ax5/pdb RCSB RCSB034419 ? ? WWPDB D_1000034419 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-27 2 'Structure model' 1 1 2008-04-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2AX5 _pdbx_database_status.recvd_initial_deposition_date 2005-09-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xu, J.' 1 'Huang, H.' 2 'Zhang, J.' 3 'Wu, J.' 4 'Shi, Y.' 5 # _citation.id primary _citation.title 'Solution structure of Urm1 and its implications for the origin of protein modifiers.' _citation.journal_abbrev Proc.Natl.Acad.Sci.Usa _citation.journal_volume 103 _citation.page_first 11625 _citation.page_last 11630 _citation.year 2006 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16864801 _citation.pdbx_database_id_DOI 10.1073/pnas.0604876103 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, J.' 1 ? primary 'Zhang, J.' 2 ? primary 'Wang, L.' 3 ? primary 'Zhou, J.' 4 ? primary 'Huang, H.' 5 ? primary 'Wu, J.' 6 ? primary 'Zhong, Y.' 7 ? primary 'Shi, Y.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical 11.0 kDa protein in FAA3-MAS3 intergenic region' _entity.formula_weight 12110.580 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ubiquitin-related modifier-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGIITLINDTDWELEGEK DYILEDGDIISFTSTLHGGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGIITLINDTDWELEGEK DYILEDGDIISFTSTLHGGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 ASN n 1 4 VAL n 1 5 LYS n 1 6 VAL n 1 7 GLU n 1 8 PHE n 1 9 LEU n 1 10 GLY n 1 11 GLY n 1 12 LEU n 1 13 ASP n 1 14 ALA n 1 15 ILE n 1 16 PHE n 1 17 GLY n 1 18 LYS n 1 19 GLN n 1 20 ARG n 1 21 VAL n 1 22 HIS n 1 23 LYS n 1 24 ILE n 1 25 LYS n 1 26 MET n 1 27 ASP n 1 28 LYS n 1 29 GLU n 1 30 ASP n 1 31 PRO n 1 32 VAL n 1 33 THR n 1 34 VAL n 1 35 GLY n 1 36 ASP n 1 37 LEU n 1 38 ILE n 1 39 ASP n 1 40 HIS n 1 41 ILE n 1 42 VAL n 1 43 SER n 1 44 THR n 1 45 MET n 1 46 ILE n 1 47 ASN n 1 48 ASN n 1 49 PRO n 1 50 ASN n 1 51 ASP n 1 52 VAL n 1 53 SER n 1 54 ILE n 1 55 PHE n 1 56 ILE n 1 57 GLU n 1 58 ASP n 1 59 ASP n 1 60 SER n 1 61 ILE n 1 62 ARG n 1 63 PRO n 1 64 GLY n 1 65 ILE n 1 66 ILE n 1 67 THR n 1 68 LEU n 1 69 ILE n 1 70 ASN n 1 71 ASP n 1 72 THR n 1 73 ASP n 1 74 TRP n 1 75 GLU n 1 76 LEU n 1 77 GLU n 1 78 GLY n 1 79 GLU n 1 80 LYS n 1 81 ASP n 1 82 TYR n 1 83 ILE n 1 84 LEU n 1 85 GLU n 1 86 ASP n 1 87 GLY n 1 88 ASP n 1 89 ILE n 1 90 ILE n 1 91 SER n 1 92 PHE n 1 93 THR n 1 94 SER n 1 95 THR n 1 96 LEU n 1 97 HIS n 1 98 GLY n 1 99 GLY n 1 100 LEU n 1 101 GLU n 1 102 HIS n 1 103 HIS n 1 104 HIS n 1 105 HIS n 1 106 HIS n 1 107 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene YIL008W _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET22b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 TRP 74 74 74 TRP TRP A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 LEU 100 100 ? ? ? A . n A 1 101 GLU 101 101 ? ? ? A . n A 1 102 HIS 102 102 ? ? ? A . n A 1 103 HIS 103 103 ? ? ? A . n A 1 104 HIS 104 104 ? ? ? A . n A 1 105 HIS 105 105 ? ? ? A . n A 1 106 HIS 106 106 ? ? ? A . n A 1 107 HIS 107 107 ? ? ? A . n # _exptl.entry_id 2AX5 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2AX5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2AX5 _struct.title 'Solution Structure of Urm1 from Saccharomyces Cerevisiae' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2AX5 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'Beta grasp fold, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code URM1_YEAST _struct_ref.pdbx_db_accession P40554 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2AX5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 99 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P40554 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 99 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 99 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2AX5 LEU A 100 ? UNP P40554 ? ? 'expression tag' 100 1 1 2AX5 GLU A 101 ? UNP P40554 ? ? 'expression tag' 101 2 1 2AX5 HIS A 102 ? UNP P40554 ? ? 'expression tag' 102 3 1 2AX5 HIS A 103 ? UNP P40554 ? ? 'expression tag' 103 4 1 2AX5 HIS A 104 ? UNP P40554 ? ? 'expression tag' 104 5 1 2AX5 HIS A 105 ? UNP P40554 ? ? 'expression tag' 105 6 1 2AX5 HIS A 106 ? UNP P40554 ? ? 'expression tag' 106 7 1 2AX5 HIS A 107 ? UNP P40554 ? ? 'expression tag' 107 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 12 ? GLY A 17 ? LEU A 12 GLY A 17 1 ? 6 HELX_P HELX_P2 2 THR A 33 ? THR A 44 ? THR A 33 THR A 44 1 ? 12 HELX_P HELX_P3 3 ASP A 51 ? ILE A 56 ? ASP A 51 ILE A 56 1 ? 6 HELX_P HELX_P4 4 ASP A 73 ? GLY A 78 ? ASP A 73 GLY A 78 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 22 ? ILE A 24 ? HIS A 22 ILE A 24 A 2 VAL A 4 ? PHE A 8 ? VAL A 4 PHE A 8 A 3 ASP A 88 ? SER A 94 ? ASP A 88 SER A 94 A 4 ILE A 65 ? ILE A 69 ? ILE A 65 ILE A 69 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O HIS A 22 ? O HIS A 22 N VAL A 6 ? N VAL A 6 A 2 3 N GLU A 7 ? N GLU A 7 O PHE A 92 ? O PHE A 92 A 3 4 O THR A 93 ? O THR A 93 N ILE A 66 ? N ILE A 66 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 28 ? ? -149.37 -69.33 2 1 SER A 43 ? ? -99.33 -77.52 3 1 ASN A 47 ? ? -157.15 74.05 4 1 ASN A 50 ? ? -171.86 -44.93 5 1 GLU A 77 ? ? -76.15 -72.20 6 1 GLU A 79 ? ? 56.71 -83.98 7 1 ASP A 81 ? ? -91.56 31.09 8 1 GLU A 85 ? ? -167.64 101.06 9 1 THR A 95 ? ? -94.43 53.99 10 2 LYS A 28 ? ? -156.09 -50.49 11 2 SER A 43 ? ? -81.87 -78.79 12 2 PRO A 49 ? ? -63.52 77.56 13 2 ASN A 50 ? ? -162.26 -54.32 14 2 GLU A 85 ? ? -165.42 102.08 15 2 SER A 94 ? ? -155.34 82.18 16 3 PHE A 16 ? ? -67.38 -75.19 17 3 LYS A 28 ? ? -155.49 -49.35 18 3 SER A 43 ? ? -92.67 -74.83 19 3 ASN A 47 ? ? -162.24 74.96 20 3 PRO A 49 ? ? -61.67 79.53 21 3 ASN A 50 ? ? -172.88 -51.33 22 3 GLU A 57 ? ? -71.85 -162.97 23 3 ASP A 58 ? ? -64.43 86.93 24 3 GLU A 77 ? ? -120.96 -50.90 25 3 GLU A 85 ? ? -165.88 100.96 26 4 PHE A 16 ? ? -58.61 -70.40 27 4 ASP A 27 ? ? -91.93 48.52 28 4 SER A 43 ? ? -95.33 -64.59 29 4 ASN A 47 ? ? -173.87 72.51 30 4 ASN A 50 ? ? -158.85 -49.00 31 4 GLU A 77 ? ? -137.31 -58.53 32 4 GLU A 79 ? ? -49.61 -71.42 33 4 GLU A 85 ? ? -162.74 99.71 34 4 ASP A 86 ? ? -43.50 105.05 35 4 HIS A 97 ? ? 73.08 114.27 36 5 PHE A 16 ? ? -69.65 -70.44 37 5 ASP A 27 ? ? 56.59 76.13 38 5 LYS A 28 ? ? -136.67 -67.57 39 5 SER A 43 ? ? -92.70 -68.81 40 5 ASN A 47 ? ? -143.91 51.41 41 5 PRO A 49 ? ? -63.32 74.41 42 5 ASN A 50 ? ? -167.63 -58.35 43 5 GLU A 79 ? ? 61.76 -78.50 44 5 ASP A 81 ? ? -93.52 47.52 45 5 LEU A 84 ? ? -59.75 173.78 46 5 GLU A 85 ? ? -161.65 100.50 47 5 ASP A 86 ? ? -43.07 105.03 48 5 LEU A 96 ? ? 61.49 102.19 49 6 LYS A 28 ? ? -166.29 -53.41 50 6 GLU A 29 ? ? -174.07 -166.59 51 6 SER A 43 ? ? -100.72 -64.33 52 6 ASN A 47 ? ? -162.56 41.22 53 6 PRO A 49 ? ? -60.37 75.06 54 6 ASN A 50 ? ? -165.72 -61.13 55 6 ASP A 58 ? ? -63.16 93.04 56 6 GLU A 85 ? ? -167.11 100.84 57 6 LEU A 96 ? ? 65.43 -68.22 58 7 PHE A 16 ? ? -67.38 -75.09 59 7 LYS A 28 ? ? -171.68 -48.28 60 7 SER A 43 ? ? -93.43 -74.87 61 7 ASN A 47 ? ? -159.81 71.72 62 7 ASN A 50 ? ? -161.73 -45.68 63 7 PRO A 63 ? ? -53.76 101.05 64 7 GLU A 77 ? ? -126.26 -52.06 65 7 GLU A 85 ? ? -169.60 101.85 66 8 ARG A 20 ? ? -72.52 -72.02 67 8 ASP A 27 ? ? 58.66 98.69 68 8 LYS A 28 ? ? -172.60 -45.82 69 8 SER A 43 ? ? -100.21 -60.83 70 8 ASN A 50 ? ? -168.17 -47.95 71 8 GLU A 57 ? ? -77.96 -163.24 72 8 ASP A 58 ? ? -65.97 84.94 73 8 GLU A 77 ? ? -131.20 -68.63 74 8 GLU A 79 ? ? -52.74 -72.68 75 8 GLU A 85 ? ? -165.59 101.32 76 8 LEU A 96 ? ? 64.04 74.32 77 8 HIS A 97 ? ? -164.11 40.47 78 9 LYS A 28 ? ? -132.30 -66.33 79 9 SER A 43 ? ? -88.30 -74.95 80 9 ASN A 50 ? ? -168.50 -44.80 81 9 GLU A 79 ? ? 172.80 -80.96 82 9 GLU A 85 ? ? -160.53 97.33 83 9 THR A 95 ? ? -104.07 -82.57 84 9 LEU A 96 ? ? 51.19 86.45 85 10 PHE A 16 ? ? -68.94 -71.66 86 10 ARG A 20 ? ? 72.63 -67.44 87 10 LYS A 28 ? ? -162.54 -67.91 88 10 SER A 43 ? ? -94.46 -75.79 89 10 ASN A 47 ? ? -165.35 47.28 90 10 PRO A 49 ? ? -62.41 77.03 91 10 ASN A 50 ? ? -170.83 -58.77 92 10 ASP A 58 ? ? 57.62 77.27 93 10 GLU A 79 ? ? 170.06 -80.95 94 10 GLU A 85 ? ? -173.86 103.89 95 10 ASP A 86 ? ? -38.67 106.35 96 10 PHE A 92 ? ? -119.57 79.98 97 10 THR A 95 ? ? -97.20 39.64 98 10 HIS A 97 ? ? -152.95 -45.65 99 11 PHE A 16 ? ? -69.84 -74.66 100 11 ASP A 27 ? ? -97.21 47.76 101 11 LYS A 28 ? ? -106.72 -164.73 102 11 GLU A 29 ? ? -68.32 -171.27 103 11 SER A 43 ? ? -100.22 -62.68 104 11 ASN A 47 ? ? -171.23 72.88 105 11 PRO A 49 ? ? -63.81 77.02 106 11 ASN A 50 ? ? -174.36 -54.74 107 11 GLU A 57 ? ? -118.48 61.83 108 11 ASP A 58 ? ? 57.97 84.78 109 11 SER A 60 ? ? -170.10 118.99 110 11 GLU A 85 ? ? -163.07 100.57 111 11 THR A 95 ? ? -118.13 72.50 112 12 PHE A 16 ? ? -63.72 -73.80 113 12 LYS A 28 ? ? -144.71 -67.60 114 12 SER A 43 ? ? -100.99 -69.57 115 12 ASN A 47 ? ? -149.03 59.17 116 12 ASN A 50 ? ? -159.11 -49.52 117 12 GLU A 77 ? ? -123.32 -71.55 118 12 GLU A 79 ? ? -54.92 -72.54 119 12 TYR A 82 ? ? -56.38 106.13 120 12 GLU A 85 ? ? -160.36 97.83 121 12 ASP A 86 ? ? -47.80 104.10 122 12 LEU A 96 ? ? -157.27 28.98 123 12 HIS A 97 ? ? 62.56 178.46 124 13 PHE A 16 ? ? -65.02 -71.46 125 13 LYS A 28 ? ? -132.93 -159.12 126 13 GLU A 29 ? ? -65.45 -170.78 127 13 SER A 43 ? ? -100.25 -72.41 128 13 ASN A 48 ? ? -172.78 119.93 129 13 PRO A 49 ? ? -62.63 76.85 130 13 ASN A 50 ? ? -166.14 -57.31 131 13 GLU A 85 ? ? -167.01 101.12 132 13 THR A 95 ? ? -90.98 52.73 133 14 SER A 43 ? ? -100.29 -72.73 134 14 ASN A 47 ? ? -165.20 41.37 135 14 ASN A 50 ? ? -169.38 -47.54 136 14 GLU A 57 ? ? -87.10 -156.28 137 14 SER A 60 ? ? -178.57 138.92 138 14 GLU A 85 ? ? -171.04 104.25 139 15 PHE A 16 ? ? -66.80 -71.59 140 15 LYS A 28 ? ? -117.05 -74.13 141 15 SER A 43 ? ? -92.92 -75.44 142 15 ASN A 47 ? ? -159.10 38.44 143 15 PRO A 49 ? ? -64.44 76.58 144 15 ASN A 50 ? ? -168.25 -45.70 145 15 ASP A 59 ? ? 76.28 -42.87 146 15 GLU A 85 ? ? -163.45 100.03 147 15 ASP A 86 ? ? -49.07 108.91 148 16 PHE A 16 ? ? -61.96 -73.30 149 16 LYS A 28 ? ? -120.62 -63.07 150 16 SER A 43 ? ? -76.21 -75.62 151 16 ASN A 47 ? ? -104.20 51.17 152 16 VAL A 52 ? ? -150.56 -49.10 153 16 GLU A 57 ? ? -107.15 -158.33 154 16 ASP A 58 ? ? -63.28 92.63 155 16 SER A 60 ? ? -171.45 141.04 156 16 PRO A 63 ? ? -54.57 101.94 157 16 GLU A 79 ? ? 179.72 -81.13 158 16 TYR A 82 ? ? -45.15 107.70 159 16 GLU A 85 ? ? -170.85 104.22 160 16 ASP A 86 ? ? -42.06 109.17 161 16 SER A 94 ? ? -153.92 79.94 162 16 HIS A 97 ? ? 75.86 122.79 163 17 PHE A 16 ? ? -66.80 -73.22 164 17 ASP A 27 ? ? 60.30 86.25 165 17 LYS A 28 ? ? -143.45 -66.09 166 17 GLU A 29 ? ? -162.58 -169.26 167 17 SER A 43 ? ? -99.76 -73.92 168 17 ASN A 47 ? ? -160.81 65.53 169 17 ASN A 48 ? ? -170.88 138.51 170 17 ASN A 50 ? ? -166.13 -41.84 171 17 PRO A 63 ? ? -66.63 99.59 172 17 TYR A 82 ? ? -48.99 109.53 173 17 GLU A 85 ? ? -170.16 102.60 174 17 THR A 95 ? ? -115.52 -83.56 175 17 LEU A 96 ? ? 176.67 -49.87 176 17 HIS A 97 ? ? 72.28 -69.44 177 18 PHE A 16 ? ? -66.44 -70.16 178 18 LYS A 28 ? ? -144.38 -66.04 179 18 SER A 43 ? ? -99.54 -75.74 180 18 ASN A 47 ? ? -153.00 44.01 181 18 PRO A 49 ? ? -68.55 73.85 182 18 ASN A 50 ? ? -171.39 -52.98 183 18 GLU A 85 ? ? -170.04 103.52 184 18 ASP A 86 ? ? -43.01 108.29 185 18 LEU A 96 ? ? 65.74 103.18 186 18 HIS A 97 ? ? 67.45 160.12 187 19 ASP A 27 ? ? -102.39 63.83 188 19 SER A 43 ? ? -95.54 -75.22 189 19 ASN A 47 ? ? -166.06 40.69 190 19 PRO A 49 ? ? -63.67 74.37 191 19 ASN A 50 ? ? -172.07 -58.66 192 19 GLU A 57 ? ? -93.41 -158.32 193 19 ASP A 58 ? ? -66.55 85.99 194 19 PRO A 63 ? ? -53.85 105.33 195 19 GLU A 79 ? ? 67.85 -72.41 196 19 GLU A 85 ? ? -171.39 103.65 197 19 HIS A 97 ? ? -175.23 -63.59 198 20 ARG A 20 ? ? -139.88 -56.44 199 20 ASP A 27 ? ? -93.92 43.83 200 20 GLU A 29 ? ? -65.07 -172.19 201 20 SER A 43 ? ? -93.72 -77.87 202 20 ASN A 47 ? ? -141.60 39.34 203 20 ASN A 50 ? ? -157.90 -50.91 204 20 GLU A 57 ? ? -104.17 -163.98 205 20 ASP A 58 ? ? -63.62 92.41 206 20 GLU A 79 ? ? -54.11 -71.01 207 20 GLU A 85 ? ? -173.85 103.28 208 20 ASP A 86 ? ? -35.22 111.91 209 20 PHE A 92 ? ? -150.39 79.98 # _pdbx_nmr_ensemble.entry_id 2AX5 _pdbx_nmr_ensemble.conformers_calculated_total_number 150 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2AX5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.8mM [15N, 13C] labeled Urm1 protein, 50mM phosphate buffer (pH6.5), 50mM sodium chloride, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '0.8mM [15N, 13C] labeled Urm1 protein, 50mM phosphate buffer (pH6.5), 50mM sodium chloride, 100% D2O' '100% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 3 1 3D_13C-separated_NOESY 2 # _pdbx_nmr_details.entry_id 2AX5 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_refine.entry_id 2AX5 _pdbx_nmr_refine.method 'distance geometry, simulated annealing, molecular dynamics, torsion angle dynamics' _pdbx_nmr_refine.details 'The structure is solved using a total of 1655 distance restraints and 79 dihedral angle restraints.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing NMRPipe 2.2 F.Delaglio 1 'data analysis' Sparky 3 'T.D.Goddard and D.G.Kneller' 2 'structure solution' CNS 1.1 A.T.Brunger 3 'data analysis' CSI 1.0 'David S. Wishart' 4 'data analysis' MOLMOL 2K.2 Koradi 5 refinement CNS 1.1 ? 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 100 ? A LEU 100 2 1 Y 1 A GLU 101 ? A GLU 101 3 1 Y 1 A HIS 102 ? A HIS 102 4 1 Y 1 A HIS 103 ? A HIS 103 5 1 Y 1 A HIS 104 ? A HIS 104 6 1 Y 1 A HIS 105 ? A HIS 105 7 1 Y 1 A HIS 106 ? A HIS 106 8 1 Y 1 A HIS 107 ? A HIS 107 9 2 Y 1 A LEU 100 ? A LEU 100 10 2 Y 1 A GLU 101 ? A GLU 101 11 2 Y 1 A HIS 102 ? A HIS 102 12 2 Y 1 A HIS 103 ? A HIS 103 13 2 Y 1 A HIS 104 ? A HIS 104 14 2 Y 1 A HIS 105 ? A HIS 105 15 2 Y 1 A HIS 106 ? A HIS 106 16 2 Y 1 A HIS 107 ? A HIS 107 17 3 Y 1 A LEU 100 ? A LEU 100 18 3 Y 1 A GLU 101 ? A GLU 101 19 3 Y 1 A HIS 102 ? A HIS 102 20 3 Y 1 A HIS 103 ? A HIS 103 21 3 Y 1 A HIS 104 ? A HIS 104 22 3 Y 1 A HIS 105 ? A HIS 105 23 3 Y 1 A HIS 106 ? A HIS 106 24 3 Y 1 A HIS 107 ? A HIS 107 25 4 Y 1 A LEU 100 ? A LEU 100 26 4 Y 1 A GLU 101 ? A GLU 101 27 4 Y 1 A HIS 102 ? A HIS 102 28 4 Y 1 A HIS 103 ? A HIS 103 29 4 Y 1 A HIS 104 ? A HIS 104 30 4 Y 1 A HIS 105 ? A HIS 105 31 4 Y 1 A HIS 106 ? A HIS 106 32 4 Y 1 A HIS 107 ? A HIS 107 33 5 Y 1 A LEU 100 ? A LEU 100 34 5 Y 1 A GLU 101 ? A GLU 101 35 5 Y 1 A HIS 102 ? A HIS 102 36 5 Y 1 A HIS 103 ? A HIS 103 37 5 Y 1 A HIS 104 ? A HIS 104 38 5 Y 1 A HIS 105 ? A HIS 105 39 5 Y 1 A HIS 106 ? A HIS 106 40 5 Y 1 A HIS 107 ? A HIS 107 41 6 Y 1 A LEU 100 ? A LEU 100 42 6 Y 1 A GLU 101 ? A GLU 101 43 6 Y 1 A HIS 102 ? A HIS 102 44 6 Y 1 A HIS 103 ? A HIS 103 45 6 Y 1 A HIS 104 ? A HIS 104 46 6 Y 1 A HIS 105 ? A HIS 105 47 6 Y 1 A HIS 106 ? A HIS 106 48 6 Y 1 A HIS 107 ? A HIS 107 49 7 Y 1 A LEU 100 ? A LEU 100 50 7 Y 1 A GLU 101 ? A GLU 101 51 7 Y 1 A HIS 102 ? A HIS 102 52 7 Y 1 A HIS 103 ? A HIS 103 53 7 Y 1 A HIS 104 ? A HIS 104 54 7 Y 1 A HIS 105 ? A HIS 105 55 7 Y 1 A HIS 106 ? A HIS 106 56 7 Y 1 A HIS 107 ? A HIS 107 57 8 Y 1 A LEU 100 ? A LEU 100 58 8 Y 1 A GLU 101 ? A GLU 101 59 8 Y 1 A HIS 102 ? A HIS 102 60 8 Y 1 A HIS 103 ? A HIS 103 61 8 Y 1 A HIS 104 ? A HIS 104 62 8 Y 1 A HIS 105 ? A HIS 105 63 8 Y 1 A HIS 106 ? A HIS 106 64 8 Y 1 A HIS 107 ? A HIS 107 65 9 Y 1 A LEU 100 ? A LEU 100 66 9 Y 1 A GLU 101 ? A GLU 101 67 9 Y 1 A HIS 102 ? A HIS 102 68 9 Y 1 A HIS 103 ? A HIS 103 69 9 Y 1 A HIS 104 ? A HIS 104 70 9 Y 1 A HIS 105 ? A HIS 105 71 9 Y 1 A HIS 106 ? A HIS 106 72 9 Y 1 A HIS 107 ? A HIS 107 73 10 Y 1 A LEU 100 ? A LEU 100 74 10 Y 1 A GLU 101 ? A GLU 101 75 10 Y 1 A HIS 102 ? A HIS 102 76 10 Y 1 A HIS 103 ? A HIS 103 77 10 Y 1 A HIS 104 ? A HIS 104 78 10 Y 1 A HIS 105 ? A HIS 105 79 10 Y 1 A HIS 106 ? A HIS 106 80 10 Y 1 A HIS 107 ? A HIS 107 81 11 Y 1 A LEU 100 ? A LEU 100 82 11 Y 1 A GLU 101 ? A GLU 101 83 11 Y 1 A HIS 102 ? A HIS 102 84 11 Y 1 A HIS 103 ? A HIS 103 85 11 Y 1 A HIS 104 ? A HIS 104 86 11 Y 1 A HIS 105 ? A HIS 105 87 11 Y 1 A HIS 106 ? A HIS 106 88 11 Y 1 A HIS 107 ? A HIS 107 89 12 Y 1 A LEU 100 ? A LEU 100 90 12 Y 1 A GLU 101 ? A GLU 101 91 12 Y 1 A HIS 102 ? A HIS 102 92 12 Y 1 A HIS 103 ? A HIS 103 93 12 Y 1 A HIS 104 ? A HIS 104 94 12 Y 1 A HIS 105 ? A HIS 105 95 12 Y 1 A HIS 106 ? A HIS 106 96 12 Y 1 A HIS 107 ? A HIS 107 97 13 Y 1 A LEU 100 ? A LEU 100 98 13 Y 1 A GLU 101 ? A GLU 101 99 13 Y 1 A HIS 102 ? A HIS 102 100 13 Y 1 A HIS 103 ? A HIS 103 101 13 Y 1 A HIS 104 ? A HIS 104 102 13 Y 1 A HIS 105 ? A HIS 105 103 13 Y 1 A HIS 106 ? A HIS 106 104 13 Y 1 A HIS 107 ? A HIS 107 105 14 Y 1 A LEU 100 ? A LEU 100 106 14 Y 1 A GLU 101 ? A GLU 101 107 14 Y 1 A HIS 102 ? A HIS 102 108 14 Y 1 A HIS 103 ? A HIS 103 109 14 Y 1 A HIS 104 ? A HIS 104 110 14 Y 1 A HIS 105 ? A HIS 105 111 14 Y 1 A HIS 106 ? A HIS 106 112 14 Y 1 A HIS 107 ? A HIS 107 113 15 Y 1 A LEU 100 ? A LEU 100 114 15 Y 1 A GLU 101 ? A GLU 101 115 15 Y 1 A HIS 102 ? A HIS 102 116 15 Y 1 A HIS 103 ? A HIS 103 117 15 Y 1 A HIS 104 ? A HIS 104 118 15 Y 1 A HIS 105 ? A HIS 105 119 15 Y 1 A HIS 106 ? A HIS 106 120 15 Y 1 A HIS 107 ? A HIS 107 121 16 Y 1 A LEU 100 ? A LEU 100 122 16 Y 1 A GLU 101 ? A GLU 101 123 16 Y 1 A HIS 102 ? A HIS 102 124 16 Y 1 A HIS 103 ? A HIS 103 125 16 Y 1 A HIS 104 ? A HIS 104 126 16 Y 1 A HIS 105 ? A HIS 105 127 16 Y 1 A HIS 106 ? A HIS 106 128 16 Y 1 A HIS 107 ? A HIS 107 129 17 Y 1 A LEU 100 ? A LEU 100 130 17 Y 1 A GLU 101 ? A GLU 101 131 17 Y 1 A HIS 102 ? A HIS 102 132 17 Y 1 A HIS 103 ? A HIS 103 133 17 Y 1 A HIS 104 ? A HIS 104 134 17 Y 1 A HIS 105 ? A HIS 105 135 17 Y 1 A HIS 106 ? A HIS 106 136 17 Y 1 A HIS 107 ? A HIS 107 137 18 Y 1 A LEU 100 ? A LEU 100 138 18 Y 1 A GLU 101 ? A GLU 101 139 18 Y 1 A HIS 102 ? A HIS 102 140 18 Y 1 A HIS 103 ? A HIS 103 141 18 Y 1 A HIS 104 ? A HIS 104 142 18 Y 1 A HIS 105 ? A HIS 105 143 18 Y 1 A HIS 106 ? A HIS 106 144 18 Y 1 A HIS 107 ? A HIS 107 145 19 Y 1 A LEU 100 ? A LEU 100 146 19 Y 1 A GLU 101 ? A GLU 101 147 19 Y 1 A HIS 102 ? A HIS 102 148 19 Y 1 A HIS 103 ? A HIS 103 149 19 Y 1 A HIS 104 ? A HIS 104 150 19 Y 1 A HIS 105 ? A HIS 105 151 19 Y 1 A HIS 106 ? A HIS 106 152 19 Y 1 A HIS 107 ? A HIS 107 153 20 Y 1 A LEU 100 ? A LEU 100 154 20 Y 1 A GLU 101 ? A GLU 101 155 20 Y 1 A HIS 102 ? A HIS 102 156 20 Y 1 A HIS 103 ? A HIS 103 157 20 Y 1 A HIS 104 ? A HIS 104 158 20 Y 1 A HIS 105 ? A HIS 105 159 20 Y 1 A HIS 106 ? A HIS 106 160 20 Y 1 A HIS 107 ? A HIS 107 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2AX5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_