data_2B7E # _entry.id 2B7E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2B7E pdb_00002b7e 10.2210/pdb2b7e/pdb RCSB RCSB034767 ? ? WWPDB D_1000034767 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2B7E _pdbx_database_status.recvd_initial_deposition_date 2005-10-04 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gasch, A.' 1 'Wiesner, S.' 2 'Martin-Malpartida, P.' 3 'Ramirez-Espain, X.' 4 'Ruiz, L.' 5 'Macias, M.J.' 6 # _citation.id primary _citation.title ;The structure of Prp40 FF1 domain and its interaction with the crn-TPR1 motif of Clf1 gives a new insight into the binding mode of FF domains. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 281 _citation.page_first 356 _citation.page_last 364 _citation.year 2006 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16253993 _citation.pdbx_database_id_DOI 10.1074/jbc.M508047200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gasch, A.' 1 ? primary 'Wiesner, S.' 2 ? primary 'Martin-Malpartida, P.' 3 ? primary 'Ramirez-Espain, X.' 4 ? primary 'Ruiz, L.' 5 ? primary 'Macias, M.J.' 6 ? # _cell.entry_id 2B7E _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2B7E _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Pre-mRNA processing protein PRP40' _entity.formula_weight 7159.096 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'FF1 domain (residues 134-189)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GAMEAEKEFITMLKENQVDSTWSFSRIISELGTRDPRYWMVDDDPLWKKEMFEKYLSNR _entity_poly.pdbx_seq_one_letter_code_can GAMEAEKEFITMLKENQVDSTWSFSRIISELGTRDPRYWMVDDDPLWKKEMFEKYLSNR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLU n 1 5 ALA n 1 6 GLU n 1 7 LYS n 1 8 GLU n 1 9 PHE n 1 10 ILE n 1 11 THR n 1 12 MET n 1 13 LEU n 1 14 LYS n 1 15 GLU n 1 16 ASN n 1 17 GLN n 1 18 VAL n 1 19 ASP n 1 20 SER n 1 21 THR n 1 22 TRP n 1 23 SER n 1 24 PHE n 1 25 SER n 1 26 ARG n 1 27 ILE n 1 28 ILE n 1 29 SER n 1 30 GLU n 1 31 LEU n 1 32 GLY n 1 33 THR n 1 34 ARG n 1 35 ASP n 1 36 PRO n 1 37 ARG n 1 38 TYR n 1 39 TRP n 1 40 MET n 1 41 VAL n 1 42 ASP n 1 43 ASP n 1 44 ASP n 1 45 PRO n 1 46 LEU n 1 47 TRP n 1 48 LYS n 1 49 LYS n 1 50 GLU n 1 51 MET n 1 52 PHE n 1 53 GLU n 1 54 LYS n 1 55 TYR n 1 56 LEU n 1 57 SER n 1 58 ASN n 1 59 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene PRP40 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRP40_YEAST _struct_ref.pdbx_db_accession P33203 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EAEKEFITMLKENQVDSTWSFSRIISELGTRDPRYWMVDDDPLWKKEMFEKYLSNR _struct_ref.pdbx_align_begin 134 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2B7E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 59 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P33203 _struct_ref_seq.db_align_beg 134 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 189 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 59 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2B7E GLY A 1 ? UNP P33203 ? ? 'cloning artifact' 1 1 1 2B7E ALA A 2 ? UNP P33203 ? ? 'cloning artifact' 2 2 1 2B7E MET A 3 ? UNP P33203 ? ? 'cloning artifact' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 '2D TOCSY' 1 3 1 3D_15N-separated_NOESY 2 4 1 3D_13C-separated_NOESY 3 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 285 1 5.5 2.2 atm K 2 280 1 5.5 2.2 atm K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 'Prp40, 50mM phosphate buffer Na, 100mM NaCl, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 'Prp40 U-15N, 50mM phosphate buffer Na, 100 mM NaCl, 90% H2O, 10% D2O' '90% H2O/10% D2O' 3 'Prp40 U-15N U-13C, 50mM phosphate buffer Na, 100 mM NaCl, 90% H2O, 10% D2O' '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DRX Bruker 500 ? 2 DRX Bruker 600 ? 3 DRX Bruker 800 ? # _pdbx_nmr_refine.entry_id 2B7E _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2B7E _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 12 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.6 Bruker 1 processing NMRPipe 3.6 'Delaglio, F.' 2 refinement CNS 1.1 ? 3 # _exptl.entry_id 2B7E _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2B7E _struct.title 'First FF domain of Prp40 Yeast Protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2B7E _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text 'STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 3 ? ASN A 16 ? MET A 3 ASN A 16 1 ? 14 HELX_P HELX_P2 2 SER A 23 ? ASP A 35 ? SER A 23 ASP A 35 1 ? 13 HELX_P HELX_P3 3 PRO A 36 ? VAL A 41 ? PRO A 36 VAL A 41 1 ? 6 HELX_P HELX_P4 4 ASP A 44 ? ASN A 58 ? ASP A 44 ASN A 58 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2B7E _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2B7E _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 ARG 59 59 59 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-01 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 11 OD2 A ASP 35 ? ? HH21 A ARG 37 ? ? 1.57 2 12 HA A ASP 43 ? ? HZ3 A LYS 48 ? ? 1.31 3 12 OE1 A GLU 6 ? ? HZ3 A LYS 7 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -91.15 59.53 2 1 MET A 3 ? ? -113.14 -81.21 3 1 ASP A 19 ? ? -154.01 -159.71 4 1 THR A 21 ? ? -85.30 45.91 5 1 PRO A 36 ? ? -68.98 14.45 6 2 ASP A 19 ? ? -148.62 -156.37 7 2 ASP A 43 ? ? -68.39 96.68 8 3 ASP A 19 ? ? -142.07 -159.45 9 3 THR A 33 ? ? -132.02 -54.00 10 4 ASP A 43 ? ? -63.33 98.09 11 4 ASN A 58 ? ? -171.11 -66.24 12 5 ASN A 58 ? ? -153.09 -49.79 13 6 MET A 3 ? ? -106.89 -62.09 14 6 ASP A 19 ? ? -157.94 -158.81 15 6 PRO A 36 ? ? -69.46 27.56 16 7 ALA A 2 ? ? -97.65 40.94 17 7 ASP A 19 ? ? -150.34 -157.46 18 8 MET A 3 ? ? -92.61 -63.38 19 9 ALA A 2 ? ? -108.56 61.31 20 9 MET A 3 ? ? -106.65 -97.91 21 9 ASP A 19 ? ? -128.58 -156.00 22 9 ASN A 58 ? ? -126.41 -53.06 23 10 ASP A 19 ? ? -120.57 -162.58 24 10 PRO A 36 ? ? -66.74 4.50 25 12 MET A 3 ? ? -105.53 -66.94 26 12 ASP A 19 ? ? -168.71 -154.70 27 12 THR A 21 ? ? -83.91 34.77 28 12 ASP A 43 ? ? -68.87 95.43 #