data_2B86 # _entry.id 2B86 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2B86 pdb_00002b86 10.2210/pdb2b86/pdb RCSB RCSB034795 ? ? WWPDB D_1000034795 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-05-09 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2B86 _pdbx_database_status.recvd_initial_deposition_date 2005-10-06 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Park, S.' 1 'Takeuchi, K.' 2 'Wagner, G.' 3 # _citation.id primary _citation.title 'Solution structure of the first SRC homology 3 domain of human nck2' _citation.journal_abbrev J.BIOMOL.NMR _citation.journal_volume 34 _citation.page_first 203 _citation.page_last 208 _citation.year 2006 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16604428 _citation.pdbx_database_id_DOI 10.1007/s10858-006-0019-5 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Park, S.' 1 ? primary 'Takeuchi, K.' 2 ? primary 'Wagner, G.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cytoplasmic protein NCK2' _entity.formula_weight 8253.205 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'First SH3 domain, residues 1-59' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NCK adaptor protein 2, SH2/SH3 adaptor protein NCK-beta, Nck-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKLEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 GLU n 1 4 GLU n 1 5 VAL n 1 6 ILE n 1 7 VAL n 1 8 ILE n 1 9 ALA n 1 10 LYS n 1 11 TRP n 1 12 ASP n 1 13 TYR n 1 14 THR n 1 15 ALA n 1 16 GLN n 1 17 GLN n 1 18 ASP n 1 19 GLN n 1 20 GLU n 1 21 LEU n 1 22 ASP n 1 23 ILE n 1 24 LYS n 1 25 LYS n 1 26 ASN n 1 27 GLU n 1 28 ARG n 1 29 LEU n 1 30 TRP n 1 31 LEU n 1 32 LEU n 1 33 ASP n 1 34 ASP n 1 35 SER n 1 36 LYS n 1 37 THR n 1 38 TRP n 1 39 TRP n 1 40 ARG n 1 41 VAL n 1 42 ARG n 1 43 ASN n 1 44 ALA n 1 45 ALA n 1 46 ASN n 1 47 ARG n 1 48 THR n 1 49 GLY n 1 50 TYR n 1 51 VAL n 1 52 PRO n 1 53 SER n 1 54 ASN n 1 55 TYR n 1 56 VAL n 1 57 GLU n 1 58 ARG n 1 59 LYS n 1 60 LEU n 1 61 GLU n 1 62 HIS n 1 63 HIS n 1 64 HIS n 1 65 HIS n 1 66 HIS n 1 67 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene NCK2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET30a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LEU 60 60 ? ? ? A . n A 1 61 GLU 61 61 ? ? ? A . n A 1 62 HIS 62 62 ? ? ? A . n A 1 63 HIS 63 63 ? ? ? A . n A 1 64 HIS 64 64 ? ? ? A . n A 1 65 HIS 65 65 ? ? ? A . n A 1 66 HIS 66 66 ? ? ? A . n A 1 67 HIS 67 67 ? ? ? A . n # _cell.entry_id 2B86 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2B86 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 2B86 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 2B86 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2B86 _struct.title 'Solution structure of the first Src homology 3 domain of Nck2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2B86 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'Nck SH3 domain, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NCK2_HUMAN _struct_ref.pdbx_db_accession O43639 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2B86 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 59 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O43639 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 59 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 59 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2B86 LEU A 60 ? UNP O43639 ? ? 'cloning artifact' 60 1 1 2B86 GLU A 61 ? UNP O43639 ? ? 'cloning artifact' 61 2 1 2B86 HIS A 62 ? UNP O43639 ? ? 'expression tag' 62 3 1 2B86 HIS A 63 ? UNP O43639 ? ? 'expression tag' 63 4 1 2B86 HIS A 64 ? UNP O43639 ? ? 'expression tag' 64 5 1 2B86 HIS A 65 ? UNP O43639 ? ? 'expression tag' 65 6 1 2B86 HIS A 66 ? UNP O43639 ? ? 'expression tag' 66 7 1 2B86 HIS A 67 ? UNP O43639 ? ? 'expression tag' 67 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 48 ? TYR A 50 ? THR A 48 TYR A 50 A 2 ARG A 40 ? ARG A 42 ? ARG A 40 ARG A 42 A 3 ARG A 28 ? ASP A 33 ? ARG A 28 ASP A 33 A 4 VAL A 5 ? ALA A 9 ? VAL A 5 ALA A 9 A 5 VAL A 56 ? ARG A 58 ? VAL A 56 ARG A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLY A 49 ? O GLY A 49 N VAL A 41 ? N VAL A 41 A 2 3 O ARG A 40 ? O ARG A 40 N LEU A 32 ? N LEU A 32 A 3 4 O LEU A 31 ? O LEU A 31 N VAL A 5 ? N VAL A 5 A 4 5 N ILE A 8 ? N ILE A 8 O GLU A 57 ? O GLU A 57 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 10 HE2 A GLU 20 ? ? HZ3 A TRP 38 ? ? 1.29 2 12 HE2 A GLU 20 ? ? HZ3 A TRP 38 ? ? 1.33 3 14 HB2 A GLN 16 ? ? HE2 A GLU 20 ? ? 1.35 4 16 HG A LEU 31 ? ? HD2 A ASP 34 ? ? 1.23 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 55 ? ? -86.91 44.21 2 2 ASN A 26 ? ? -140.00 22.21 3 2 ASP A 33 ? ? -160.99 117.41 4 2 PRO A 52 ? ? -73.63 36.99 5 2 SER A 53 ? ? -67.69 92.98 6 3 PRO A 52 ? ? -72.90 36.60 7 3 SER A 53 ? ? -65.06 97.72 8 5 ASP A 33 ? ? -133.72 -66.37 9 5 ASP A 34 ? ? 51.60 16.41 10 5 PRO A 52 ? ? -72.23 46.46 11 6 ASP A 33 ? ? -161.40 118.36 12 6 PRO A 52 ? ? -78.26 43.33 13 7 PRO A 52 ? ? -83.21 39.63 14 7 SER A 53 ? ? -68.50 90.05 15 8 PRO A 52 ? ? -75.80 44.34 16 9 PRO A 52 ? ? -77.31 33.11 17 9 SER A 53 ? ? -59.10 100.78 18 10 ASN A 26 ? ? -141.11 27.24 19 10 PRO A 52 ? ? -71.16 36.23 20 10 SER A 53 ? ? -67.00 93.45 21 11 ASP A 33 ? ? -161.02 119.86 22 11 PRO A 52 ? ? -76.94 31.11 23 11 SER A 53 ? ? -62.43 87.24 24 12 PRO A 52 ? ? -73.86 32.93 25 12 SER A 53 ? ? -65.04 91.69 26 13 PRO A 52 ? ? -76.08 42.81 27 14 ASN A 26 ? ? -141.52 28.35 28 14 SER A 53 ? ? -58.66 91.89 29 15 ASN A 26 ? ? -151.97 29.38 30 15 SER A 53 ? ? -66.97 94.36 31 16 ASP A 33 ? ? -160.99 118.16 32 16 PRO A 52 ? ? -72.33 30.92 33 16 SER A 53 ? ? -66.00 85.51 34 17 ASP A 33 ? ? -160.99 118.88 35 17 PRO A 52 ? ? -74.73 45.24 36 17 SER A 53 ? ? -69.61 73.63 37 18 PRO A 52 ? ? -74.84 41.63 38 19 ASN A 26 ? ? -140.54 25.35 39 19 ASP A 33 ? ? -160.68 116.96 40 19 PRO A 52 ? ? -76.63 44.40 41 20 PRO A 52 ? ? -70.77 44.50 42 21 ASN A 26 ? ? -141.78 27.73 43 21 PRO A 52 ? ? -70.98 35.40 44 21 SER A 53 ? ? -67.93 81.46 45 22 ASP A 33 ? ? -161.87 118.38 46 22 PRO A 52 ? ? -72.05 32.64 47 23 ASP A 33 ? ? -160.99 118.47 48 23 PRO A 52 ? ? -73.99 35.87 49 23 SER A 53 ? ? -68.54 87.52 50 24 ASN A 26 ? ? -140.72 24.77 51 24 PRO A 52 ? ? -75.35 43.58 52 24 SER A 53 ? ? -63.76 97.07 53 25 PRO A 52 ? ? -72.41 32.41 54 25 SER A 53 ? ? -68.40 84.81 55 26 ASP A 33 ? ? -113.28 -83.74 56 26 PRO A 52 ? ? -74.24 43.21 57 27 ASN A 26 ? ? -140.68 26.40 58 27 PRO A 52 ? ? -70.18 41.16 59 27 SER A 53 ? ? -69.03 74.19 60 28 ASN A 26 ? ? -140.60 23.34 61 28 SER A 53 ? ? -66.92 92.99 62 29 ASP A 33 ? ? -161.05 118.08 63 29 PRO A 52 ? ? -73.54 31.59 64 29 SER A 53 ? ? -61.72 93.95 65 30 ASP A 33 ? ? -160.97 117.71 66 30 PRO A 52 ? ? -73.09 45.44 # _pdbx_nmr_ensemble.entry_id 2B86 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2B86 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '600uM Nck SH3 domain U-15N, 13C, 50mM Sodium Phosphate, 50mM EDTA, pH 6.5, 5% D2O, 95% H2O' _pdbx_nmr_sample_details.solvent_system '5% D2O, 95% H2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 '2D TOCSY' 1 3 1 3D_13C-separated_NOESY 1 4 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_details.entry_id 2B86 _pdbx_nmr_details.text 'cryogenic probes' # _pdbx_nmr_refine.entry_id 2B86 _pdbx_nmr_refine.method ;simulated annealing tortion angle dynamics ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' CNS 1.1 Brunger 1 processing NMRPipe 2.3 Delaglio 2 refinement CNS 1.1 Brunger 3 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 60 ? A LEU 60 2 1 Y 1 A GLU 61 ? A GLU 61 3 1 Y 1 A HIS 62 ? A HIS 62 4 1 Y 1 A HIS 63 ? A HIS 63 5 1 Y 1 A HIS 64 ? A HIS 64 6 1 Y 1 A HIS 65 ? A HIS 65 7 1 Y 1 A HIS 66 ? A HIS 66 8 1 Y 1 A HIS 67 ? A HIS 67 9 2 Y 1 A LEU 60 ? A LEU 60 10 2 Y 1 A GLU 61 ? A GLU 61 11 2 Y 1 A HIS 62 ? A HIS 62 12 2 Y 1 A HIS 63 ? A HIS 63 13 2 Y 1 A HIS 64 ? A HIS 64 14 2 Y 1 A HIS 65 ? A HIS 65 15 2 Y 1 A HIS 66 ? A HIS 66 16 2 Y 1 A HIS 67 ? A HIS 67 17 3 Y 1 A LEU 60 ? A LEU 60 18 3 Y 1 A GLU 61 ? A GLU 61 19 3 Y 1 A HIS 62 ? A HIS 62 20 3 Y 1 A HIS 63 ? A HIS 63 21 3 Y 1 A HIS 64 ? A HIS 64 22 3 Y 1 A HIS 65 ? A HIS 65 23 3 Y 1 A HIS 66 ? A HIS 66 24 3 Y 1 A HIS 67 ? A HIS 67 25 4 Y 1 A LEU 60 ? A LEU 60 26 4 Y 1 A GLU 61 ? A GLU 61 27 4 Y 1 A HIS 62 ? A HIS 62 28 4 Y 1 A HIS 63 ? A HIS 63 29 4 Y 1 A HIS 64 ? A HIS 64 30 4 Y 1 A HIS 65 ? A HIS 65 31 4 Y 1 A HIS 66 ? A HIS 66 32 4 Y 1 A HIS 67 ? A HIS 67 33 5 Y 1 A LEU 60 ? A LEU 60 34 5 Y 1 A GLU 61 ? A GLU 61 35 5 Y 1 A HIS 62 ? A HIS 62 36 5 Y 1 A HIS 63 ? A HIS 63 37 5 Y 1 A HIS 64 ? A HIS 64 38 5 Y 1 A HIS 65 ? A HIS 65 39 5 Y 1 A HIS 66 ? A HIS 66 40 5 Y 1 A HIS 67 ? A HIS 67 41 6 Y 1 A LEU 60 ? A LEU 60 42 6 Y 1 A GLU 61 ? A GLU 61 43 6 Y 1 A HIS 62 ? A HIS 62 44 6 Y 1 A HIS 63 ? A HIS 63 45 6 Y 1 A HIS 64 ? A HIS 64 46 6 Y 1 A HIS 65 ? A HIS 65 47 6 Y 1 A HIS 66 ? A HIS 66 48 6 Y 1 A HIS 67 ? A HIS 67 49 7 Y 1 A LEU 60 ? A LEU 60 50 7 Y 1 A GLU 61 ? A GLU 61 51 7 Y 1 A HIS 62 ? A HIS 62 52 7 Y 1 A HIS 63 ? A HIS 63 53 7 Y 1 A HIS 64 ? A HIS 64 54 7 Y 1 A HIS 65 ? A HIS 65 55 7 Y 1 A HIS 66 ? A HIS 66 56 7 Y 1 A HIS 67 ? A HIS 67 57 8 Y 1 A LEU 60 ? A LEU 60 58 8 Y 1 A GLU 61 ? A GLU 61 59 8 Y 1 A HIS 62 ? A HIS 62 60 8 Y 1 A HIS 63 ? A HIS 63 61 8 Y 1 A HIS 64 ? A HIS 64 62 8 Y 1 A HIS 65 ? A HIS 65 63 8 Y 1 A HIS 66 ? A HIS 66 64 8 Y 1 A HIS 67 ? A HIS 67 65 9 Y 1 A LEU 60 ? A LEU 60 66 9 Y 1 A GLU 61 ? A GLU 61 67 9 Y 1 A HIS 62 ? A HIS 62 68 9 Y 1 A HIS 63 ? A HIS 63 69 9 Y 1 A HIS 64 ? A HIS 64 70 9 Y 1 A HIS 65 ? A HIS 65 71 9 Y 1 A HIS 66 ? A HIS 66 72 9 Y 1 A HIS 67 ? A HIS 67 73 10 Y 1 A LEU 60 ? A LEU 60 74 10 Y 1 A GLU 61 ? A GLU 61 75 10 Y 1 A HIS 62 ? A HIS 62 76 10 Y 1 A HIS 63 ? A HIS 63 77 10 Y 1 A HIS 64 ? A HIS 64 78 10 Y 1 A HIS 65 ? A HIS 65 79 10 Y 1 A HIS 66 ? A HIS 66 80 10 Y 1 A HIS 67 ? A HIS 67 81 11 Y 1 A LEU 60 ? A LEU 60 82 11 Y 1 A GLU 61 ? A GLU 61 83 11 Y 1 A HIS 62 ? A HIS 62 84 11 Y 1 A HIS 63 ? A HIS 63 85 11 Y 1 A HIS 64 ? A HIS 64 86 11 Y 1 A HIS 65 ? A HIS 65 87 11 Y 1 A HIS 66 ? A HIS 66 88 11 Y 1 A HIS 67 ? A HIS 67 89 12 Y 1 A LEU 60 ? A LEU 60 90 12 Y 1 A GLU 61 ? A GLU 61 91 12 Y 1 A HIS 62 ? A HIS 62 92 12 Y 1 A HIS 63 ? A HIS 63 93 12 Y 1 A HIS 64 ? A HIS 64 94 12 Y 1 A HIS 65 ? A HIS 65 95 12 Y 1 A HIS 66 ? A HIS 66 96 12 Y 1 A HIS 67 ? A HIS 67 97 13 Y 1 A LEU 60 ? A LEU 60 98 13 Y 1 A GLU 61 ? A GLU 61 99 13 Y 1 A HIS 62 ? A HIS 62 100 13 Y 1 A HIS 63 ? A HIS 63 101 13 Y 1 A HIS 64 ? A HIS 64 102 13 Y 1 A HIS 65 ? A HIS 65 103 13 Y 1 A HIS 66 ? A HIS 66 104 13 Y 1 A HIS 67 ? A HIS 67 105 14 Y 1 A LEU 60 ? A LEU 60 106 14 Y 1 A GLU 61 ? A GLU 61 107 14 Y 1 A HIS 62 ? A HIS 62 108 14 Y 1 A HIS 63 ? A HIS 63 109 14 Y 1 A HIS 64 ? A HIS 64 110 14 Y 1 A HIS 65 ? A HIS 65 111 14 Y 1 A HIS 66 ? A HIS 66 112 14 Y 1 A HIS 67 ? A HIS 67 113 15 Y 1 A LEU 60 ? A LEU 60 114 15 Y 1 A GLU 61 ? A GLU 61 115 15 Y 1 A HIS 62 ? A HIS 62 116 15 Y 1 A HIS 63 ? A HIS 63 117 15 Y 1 A HIS 64 ? A HIS 64 118 15 Y 1 A HIS 65 ? A HIS 65 119 15 Y 1 A HIS 66 ? A HIS 66 120 15 Y 1 A HIS 67 ? A HIS 67 121 16 Y 1 A LEU 60 ? A LEU 60 122 16 Y 1 A GLU 61 ? A GLU 61 123 16 Y 1 A HIS 62 ? A HIS 62 124 16 Y 1 A HIS 63 ? A HIS 63 125 16 Y 1 A HIS 64 ? A HIS 64 126 16 Y 1 A HIS 65 ? A HIS 65 127 16 Y 1 A HIS 66 ? A HIS 66 128 16 Y 1 A HIS 67 ? A HIS 67 129 17 Y 1 A LEU 60 ? A LEU 60 130 17 Y 1 A GLU 61 ? A GLU 61 131 17 Y 1 A HIS 62 ? A HIS 62 132 17 Y 1 A HIS 63 ? A HIS 63 133 17 Y 1 A HIS 64 ? A HIS 64 134 17 Y 1 A HIS 65 ? A HIS 65 135 17 Y 1 A HIS 66 ? A HIS 66 136 17 Y 1 A HIS 67 ? A HIS 67 137 18 Y 1 A LEU 60 ? A LEU 60 138 18 Y 1 A GLU 61 ? A GLU 61 139 18 Y 1 A HIS 62 ? A HIS 62 140 18 Y 1 A HIS 63 ? A HIS 63 141 18 Y 1 A HIS 64 ? A HIS 64 142 18 Y 1 A HIS 65 ? A HIS 65 143 18 Y 1 A HIS 66 ? A HIS 66 144 18 Y 1 A HIS 67 ? A HIS 67 145 19 Y 1 A LEU 60 ? A LEU 60 146 19 Y 1 A GLU 61 ? A GLU 61 147 19 Y 1 A HIS 62 ? A HIS 62 148 19 Y 1 A HIS 63 ? A HIS 63 149 19 Y 1 A HIS 64 ? A HIS 64 150 19 Y 1 A HIS 65 ? A HIS 65 151 19 Y 1 A HIS 66 ? A HIS 66 152 19 Y 1 A HIS 67 ? A HIS 67 153 20 Y 1 A LEU 60 ? A LEU 60 154 20 Y 1 A GLU 61 ? A GLU 61 155 20 Y 1 A HIS 62 ? A HIS 62 156 20 Y 1 A HIS 63 ? A HIS 63 157 20 Y 1 A HIS 64 ? A HIS 64 158 20 Y 1 A HIS 65 ? A HIS 65 159 20 Y 1 A HIS 66 ? A HIS 66 160 20 Y 1 A HIS 67 ? A HIS 67 161 21 Y 1 A LEU 60 ? A LEU 60 162 21 Y 1 A GLU 61 ? A GLU 61 163 21 Y 1 A HIS 62 ? A HIS 62 164 21 Y 1 A HIS 63 ? A HIS 63 165 21 Y 1 A HIS 64 ? A HIS 64 166 21 Y 1 A HIS 65 ? A HIS 65 167 21 Y 1 A HIS 66 ? A HIS 66 168 21 Y 1 A HIS 67 ? A HIS 67 169 22 Y 1 A LEU 60 ? A LEU 60 170 22 Y 1 A GLU 61 ? A GLU 61 171 22 Y 1 A HIS 62 ? A HIS 62 172 22 Y 1 A HIS 63 ? A HIS 63 173 22 Y 1 A HIS 64 ? A HIS 64 174 22 Y 1 A HIS 65 ? A HIS 65 175 22 Y 1 A HIS 66 ? A HIS 66 176 22 Y 1 A HIS 67 ? A HIS 67 177 23 Y 1 A LEU 60 ? A LEU 60 178 23 Y 1 A GLU 61 ? A GLU 61 179 23 Y 1 A HIS 62 ? A HIS 62 180 23 Y 1 A HIS 63 ? A HIS 63 181 23 Y 1 A HIS 64 ? A HIS 64 182 23 Y 1 A HIS 65 ? A HIS 65 183 23 Y 1 A HIS 66 ? A HIS 66 184 23 Y 1 A HIS 67 ? A HIS 67 185 24 Y 1 A LEU 60 ? A LEU 60 186 24 Y 1 A GLU 61 ? A GLU 61 187 24 Y 1 A HIS 62 ? A HIS 62 188 24 Y 1 A HIS 63 ? A HIS 63 189 24 Y 1 A HIS 64 ? A HIS 64 190 24 Y 1 A HIS 65 ? A HIS 65 191 24 Y 1 A HIS 66 ? A HIS 66 192 24 Y 1 A HIS 67 ? A HIS 67 193 25 Y 1 A LEU 60 ? A LEU 60 194 25 Y 1 A GLU 61 ? A GLU 61 195 25 Y 1 A HIS 62 ? A HIS 62 196 25 Y 1 A HIS 63 ? A HIS 63 197 25 Y 1 A HIS 64 ? A HIS 64 198 25 Y 1 A HIS 65 ? A HIS 65 199 25 Y 1 A HIS 66 ? A HIS 66 200 25 Y 1 A HIS 67 ? A HIS 67 201 26 Y 1 A LEU 60 ? A LEU 60 202 26 Y 1 A GLU 61 ? A GLU 61 203 26 Y 1 A HIS 62 ? A HIS 62 204 26 Y 1 A HIS 63 ? A HIS 63 205 26 Y 1 A HIS 64 ? A HIS 64 206 26 Y 1 A HIS 65 ? A HIS 65 207 26 Y 1 A HIS 66 ? A HIS 66 208 26 Y 1 A HIS 67 ? A HIS 67 209 27 Y 1 A LEU 60 ? A LEU 60 210 27 Y 1 A GLU 61 ? A GLU 61 211 27 Y 1 A HIS 62 ? A HIS 62 212 27 Y 1 A HIS 63 ? A HIS 63 213 27 Y 1 A HIS 64 ? A HIS 64 214 27 Y 1 A HIS 65 ? A HIS 65 215 27 Y 1 A HIS 66 ? A HIS 66 216 27 Y 1 A HIS 67 ? A HIS 67 217 28 Y 1 A LEU 60 ? A LEU 60 218 28 Y 1 A GLU 61 ? A GLU 61 219 28 Y 1 A HIS 62 ? A HIS 62 220 28 Y 1 A HIS 63 ? A HIS 63 221 28 Y 1 A HIS 64 ? A HIS 64 222 28 Y 1 A HIS 65 ? A HIS 65 223 28 Y 1 A HIS 66 ? A HIS 66 224 28 Y 1 A HIS 67 ? A HIS 67 225 29 Y 1 A LEU 60 ? A LEU 60 226 29 Y 1 A GLU 61 ? A GLU 61 227 29 Y 1 A HIS 62 ? A HIS 62 228 29 Y 1 A HIS 63 ? A HIS 63 229 29 Y 1 A HIS 64 ? A HIS 64 230 29 Y 1 A HIS 65 ? A HIS 65 231 29 Y 1 A HIS 66 ? A HIS 66 232 29 Y 1 A HIS 67 ? A HIS 67 233 30 Y 1 A LEU 60 ? A LEU 60 234 30 Y 1 A GLU 61 ? A GLU 61 235 30 Y 1 A HIS 62 ? A HIS 62 236 30 Y 1 A HIS 63 ? A HIS 63 237 30 Y 1 A HIS 64 ? A HIS 64 238 30 Y 1 A HIS 65 ? A HIS 65 239 30 Y 1 A HIS 66 ? A HIS 66 240 30 Y 1 A HIS 67 ? A HIS 67 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PRO N N N N 233 PRO CA C N S 234 PRO C C N N 235 PRO O O N N 236 PRO CB C N N 237 PRO CG C N N 238 PRO CD C N N 239 PRO OXT O N N 240 PRO H H N N 241 PRO HA H N N 242 PRO HB2 H N N 243 PRO HB3 H N N 244 PRO HG2 H N N 245 PRO HG3 H N N 246 PRO HD2 H N N 247 PRO HD3 H N N 248 PRO HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TRP N N N N 281 TRP CA C N S 282 TRP C C N N 283 TRP O O N N 284 TRP CB C N N 285 TRP CG C Y N 286 TRP CD1 C Y N 287 TRP CD2 C Y N 288 TRP NE1 N Y N 289 TRP CE2 C Y N 290 TRP CE3 C Y N 291 TRP CZ2 C Y N 292 TRP CZ3 C Y N 293 TRP CH2 C Y N 294 TRP OXT O N N 295 TRP H H N N 296 TRP H2 H N N 297 TRP HA H N N 298 TRP HB2 H N N 299 TRP HB3 H N N 300 TRP HD1 H N N 301 TRP HE1 H N N 302 TRP HE3 H N N 303 TRP HZ2 H N N 304 TRP HZ3 H N N 305 TRP HH2 H N N 306 TRP HXT H N N 307 TYR N N N N 308 TYR CA C N S 309 TYR C C N N 310 TYR O O N N 311 TYR CB C N N 312 TYR CG C Y N 313 TYR CD1 C Y N 314 TYR CD2 C Y N 315 TYR CE1 C Y N 316 TYR CE2 C Y N 317 TYR CZ C Y N 318 TYR OH O N N 319 TYR OXT O N N 320 TYR H H N N 321 TYR H2 H N N 322 TYR HA H N N 323 TYR HB2 H N N 324 TYR HB3 H N N 325 TYR HD1 H N N 326 TYR HD2 H N N 327 TYR HE1 H N N 328 TYR HE2 H N N 329 TYR HH H N N 330 TYR HXT H N N 331 VAL N N N N 332 VAL CA C N S 333 VAL C C N N 334 VAL O O N N 335 VAL CB C N N 336 VAL CG1 C N N 337 VAL CG2 C N N 338 VAL OXT O N N 339 VAL H H N N 340 VAL H2 H N N 341 VAL HA H N N 342 VAL HB H N N 343 VAL HG11 H N N 344 VAL HG12 H N N 345 VAL HG13 H N N 346 VAL HG21 H N N 347 VAL HG22 H N N 348 VAL HG23 H N N 349 VAL HXT H N N 350 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PRO N CA sing N N 222 PRO N CD sing N N 223 PRO N H sing N N 224 PRO CA C sing N N 225 PRO CA CB sing N N 226 PRO CA HA sing N N 227 PRO C O doub N N 228 PRO C OXT sing N N 229 PRO CB CG sing N N 230 PRO CB HB2 sing N N 231 PRO CB HB3 sing N N 232 PRO CG CD sing N N 233 PRO CG HG2 sing N N 234 PRO CG HG3 sing N N 235 PRO CD HD2 sing N N 236 PRO CD HD3 sing N N 237 PRO OXT HXT sing N N 238 SER N CA sing N N 239 SER N H sing N N 240 SER N H2 sing N N 241 SER CA C sing N N 242 SER CA CB sing N N 243 SER CA HA sing N N 244 SER C O doub N N 245 SER C OXT sing N N 246 SER CB OG sing N N 247 SER CB HB2 sing N N 248 SER CB HB3 sing N N 249 SER OG HG sing N N 250 SER OXT HXT sing N N 251 THR N CA sing N N 252 THR N H sing N N 253 THR N H2 sing N N 254 THR CA C sing N N 255 THR CA CB sing N N 256 THR CA HA sing N N 257 THR C O doub N N 258 THR C OXT sing N N 259 THR CB OG1 sing N N 260 THR CB CG2 sing N N 261 THR CB HB sing N N 262 THR OG1 HG1 sing N N 263 THR CG2 HG21 sing N N 264 THR CG2 HG22 sing N N 265 THR CG2 HG23 sing N N 266 THR OXT HXT sing N N 267 TRP N CA sing N N 268 TRP N H sing N N 269 TRP N H2 sing N N 270 TRP CA C sing N N 271 TRP CA CB sing N N 272 TRP CA HA sing N N 273 TRP C O doub N N 274 TRP C OXT sing N N 275 TRP CB CG sing N N 276 TRP CB HB2 sing N N 277 TRP CB HB3 sing N N 278 TRP CG CD1 doub Y N 279 TRP CG CD2 sing Y N 280 TRP CD1 NE1 sing Y N 281 TRP CD1 HD1 sing N N 282 TRP CD2 CE2 doub Y N 283 TRP CD2 CE3 sing Y N 284 TRP NE1 CE2 sing Y N 285 TRP NE1 HE1 sing N N 286 TRP CE2 CZ2 sing Y N 287 TRP CE3 CZ3 doub Y N 288 TRP CE3 HE3 sing N N 289 TRP CZ2 CH2 doub Y N 290 TRP CZ2 HZ2 sing N N 291 TRP CZ3 CH2 sing Y N 292 TRP CZ3 HZ3 sing N N 293 TRP CH2 HH2 sing N N 294 TRP OXT HXT sing N N 295 TYR N CA sing N N 296 TYR N H sing N N 297 TYR N H2 sing N N 298 TYR CA C sing N N 299 TYR CA CB sing N N 300 TYR CA HA sing N N 301 TYR C O doub N N 302 TYR C OXT sing N N 303 TYR CB CG sing N N 304 TYR CB HB2 sing N N 305 TYR CB HB3 sing N N 306 TYR CG CD1 doub Y N 307 TYR CG CD2 sing Y N 308 TYR CD1 CE1 sing Y N 309 TYR CD1 HD1 sing N N 310 TYR CD2 CE2 doub Y N 311 TYR CD2 HD2 sing N N 312 TYR CE1 CZ doub Y N 313 TYR CE1 HE1 sing N N 314 TYR CE2 CZ sing Y N 315 TYR CE2 HE2 sing N N 316 TYR CZ OH sing N N 317 TYR OH HH sing N N 318 TYR OXT HXT sing N N 319 VAL N CA sing N N 320 VAL N H sing N N 321 VAL N H2 sing N N 322 VAL CA C sing N N 323 VAL CA CB sing N N 324 VAL CA HA sing N N 325 VAL C O doub N N 326 VAL C OXT sing N N 327 VAL CB CG1 sing N N 328 VAL CB CG2 sing N N 329 VAL CB HB sing N N 330 VAL CG1 HG11 sing N N 331 VAL CG1 HG12 sing N N 332 VAL CG1 HG13 sing N N 333 VAL CG2 HG21 sing N N 334 VAL CG2 HG22 sing N N 335 VAL CG2 HG23 sing N N 336 VAL OXT HXT sing N N 337 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DRX Bruker 500 ? 2 INOVA Varian 500 ? 3 INOVA Varian 600 ? # _atom_sites.entry_id 2B86 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_