data_2B8G
# 
_entry.id   2B8G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.397 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2B8G         pdb_00002b8g 10.2210/pdb2b8g/pdb 
RCSB  RCSB034805   ?            ?                   
WWPDB D_1000034805 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-06-06 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-03-09 
5 'Structure model' 1 4 2024-10-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' database_2                
2  4 'Structure model' pdbx_nmr_software         
3  4 'Structure model' pdbx_nmr_spectrometer     
4  4 'Structure model' pdbx_struct_assembly      
5  4 'Structure model' pdbx_struct_oper_list     
6  4 'Structure model' struct_conn               
7  4 'Structure model' struct_site               
8  5 'Structure model' chem_comp_atom            
9  5 'Structure model' chem_comp_bond            
10 5 'Structure model' pdbx_entry_details        
11 5 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_nmr_software.name'             
4 4 'Structure model' '_pdbx_nmr_spectrometer.model'        
5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
7 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
8 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2B8G 
_pdbx_database_status.recvd_initial_deposition_date   2005-10-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2B8F 
_pdbx_database_related.details        'Bacillus subtilis BLAP Apo form' 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cui, G.' 1 
'Xia, B.' 2 
'Jin, C.' 3 
# 
_citation.id                        primary 
_citation.title                     
'solution structure of Bacillus subtilis BLAP biotinylated-form (energy minimized mean structure)' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Cui, G.' 1 ? 
primary 'Xia, B.' 2 ? 
primary 'Jin, C.' 3 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Biotin/Lipoyl Attachment Protein' 7920.094 1 ? ? ? ? 
2 non-polymer syn BIOTIN                             244.311  1 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       TVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ 
_entity_poly.pdbx_seq_one_letter_code_can   TVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        BIOTIN 
_pdbx_entity_nonpoly.comp_id     BTN 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  THR n 
1 2  VAL n 
1 3  SER n 
1 4  ILE n 
1 5  GLN n 
1 6  MET n 
1 7  ALA n 
1 8  GLY n 
1 9  ASN n 
1 10 LEU n 
1 11 TRP n 
1 12 LYS n 
1 13 VAL n 
1 14 HIS n 
1 15 VAL n 
1 16 LYS n 
1 17 ALA n 
1 18 GLY n 
1 19 ASP n 
1 20 GLN n 
1 21 ILE n 
1 22 GLU n 
1 23 LYS n 
1 24 GLY n 
1 25 GLN n 
1 26 GLU n 
1 27 VAL n 
1 28 ALA n 
1 29 ILE n 
1 30 LEU n 
1 31 GLU n 
1 32 SER n 
1 33 MET n 
1 34 LYS n 
1 35 MET n 
1 36 GLU n 
1 37 ILE n 
1 38 PRO n 
1 39 ILE n 
1 40 VAL n 
1 41 ALA n 
1 42 ASP n 
1 43 ARG n 
1 44 SER n 
1 45 GLY n 
1 46 ILE n 
1 47 VAL n 
1 48 LYS n 
1 49 GLU n 
1 50 VAL n 
1 51 LYS n 
1 52 LYS n 
1 53 LYS n 
1 54 GLU n 
1 55 GLY n 
1 56 ASP n 
1 57 PHE n 
1 58 VAL n 
1 59 ASN n 
1 60 GLU n 
1 61 GLY n 
1 62 ASP n 
1 63 VAL n 
1 64 LEU n 
1 65 LEU n 
1 66 GLU n 
1 67 LEU n 
1 68 SER n 
1 69 ASN n 
1 70 SER n 
1 71 THR n 
1 72 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Bacillus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus subtilis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1423 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET-21a(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
BTN non-polymer         . BIOTIN          ? 'C10 H16 N2 O3 S' 244.311 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'   204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'     117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  THR 1  2  2  THR THR A . n 
A 1 2  VAL 2  3  3  VAL VAL A . n 
A 1 3  SER 3  4  4  SER SER A . n 
A 1 4  ILE 4  5  5  ILE ILE A . n 
A 1 5  GLN 5  6  6  GLN GLN A . n 
A 1 6  MET 6  7  7  MET MET A . n 
A 1 7  ALA 7  8  8  ALA ALA A . n 
A 1 8  GLY 8  9  9  GLY GLY A . n 
A 1 9  ASN 9  10 10 ASN ASN A . n 
A 1 10 LEU 10 11 11 LEU LEU A . n 
A 1 11 TRP 11 12 12 TRP TRP A . n 
A 1 12 LYS 12 13 13 LYS LYS A . n 
A 1 13 VAL 13 14 14 VAL VAL A . n 
A 1 14 HIS 14 15 15 HIS HIS A . n 
A 1 15 VAL 15 16 16 VAL VAL A . n 
A 1 16 LYS 16 17 17 LYS LYS A . n 
A 1 17 ALA 17 18 18 ALA ALA A . n 
A 1 18 GLY 18 19 19 GLY GLY A . n 
A 1 19 ASP 19 20 20 ASP ASP A . n 
A 1 20 GLN 20 21 21 GLN GLN A . n 
A 1 21 ILE 21 22 22 ILE ILE A . n 
A 1 22 GLU 22 23 23 GLU GLU A . n 
A 1 23 LYS 23 24 24 LYS LYS A . n 
A 1 24 GLY 24 25 25 GLY GLY A . n 
A 1 25 GLN 25 26 26 GLN GLN A . n 
A 1 26 GLU 26 27 27 GLU GLU A . n 
A 1 27 VAL 27 28 28 VAL VAL A . n 
A 1 28 ALA 28 29 29 ALA ALA A . n 
A 1 29 ILE 29 30 30 ILE ILE A . n 
A 1 30 LEU 30 31 31 LEU LEU A . n 
A 1 31 GLU 31 32 32 GLU GLU A . n 
A 1 32 SER 32 33 33 SER SER A . n 
A 1 33 MET 33 34 34 MET MET A . n 
A 1 34 LYS 34 35 35 LYS BTL A . n 
A 1 35 MET 35 36 36 MET MET A . n 
A 1 36 GLU 36 37 37 GLU GLU A . n 
A 1 37 ILE 37 38 38 ILE ILE A . n 
A 1 38 PRO 38 39 39 PRO PRO A . n 
A 1 39 ILE 39 40 40 ILE ILE A . n 
A 1 40 VAL 40 41 41 VAL VAL A . n 
A 1 41 ALA 41 42 42 ALA ALA A . n 
A 1 42 ASP 42 43 43 ASP ASP A . n 
A 1 43 ARG 43 44 44 ARG ARG A . n 
A 1 44 SER 44 45 45 SER SER A . n 
A 1 45 GLY 45 46 46 GLY GLY A . n 
A 1 46 ILE 46 47 47 ILE ILE A . n 
A 1 47 VAL 47 48 48 VAL VAL A . n 
A 1 48 LYS 48 49 49 LYS LYS A . n 
A 1 49 GLU 49 50 50 GLU GLU A . n 
A 1 50 VAL 50 51 51 VAL VAL A . n 
A 1 51 LYS 51 52 52 LYS LYS A . n 
A 1 52 LYS 52 53 53 LYS LYS A . n 
A 1 53 LYS 53 54 54 LYS LYS A . n 
A 1 54 GLU 54 55 55 GLU GLU A . n 
A 1 55 GLY 55 56 56 GLY GLY A . n 
A 1 56 ASP 56 57 57 ASP ASP A . n 
A 1 57 PHE 57 58 58 PHE PHE A . n 
A 1 58 VAL 58 59 59 VAL VAL A . n 
A 1 59 ASN 59 60 60 ASN ASN A . n 
A 1 60 GLU 60 61 61 GLU GLU A . n 
A 1 61 GLY 61 62 62 GLY GLY A . n 
A 1 62 ASP 62 63 63 ASP ASP A . n 
A 1 63 VAL 63 64 64 VAL VAL A . n 
A 1 64 LEU 64 65 65 LEU LEU A . n 
A 1 65 LEU 65 66 66 LEU LEU A . n 
A 1 66 GLU 66 67 67 GLU GLU A . n 
A 1 67 LEU 67 68 68 LEU LEU A . n 
A 1 68 SER 68 69 69 SER SER A . n 
A 1 69 ASN 69 70 70 ASN ASN A . n 
A 1 70 SER 70 71 71 SER SER A . n 
A 1 71 THR 71 72 72 THR THR A . n 
A 1 72 GLN 72 73 73 GLN GLN A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          BTN 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     135 
_pdbx_nonpoly_scheme.auth_seq_num    35 
_pdbx_nonpoly_scheme.pdb_mon_id      BTN 
_pdbx_nonpoly_scheme.auth_mon_id     BTL 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_exptl.entry_id          2B8G 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_database_PDB_matrix.entry_id          2B8G 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  2B8G 
_struct.title                     
'solution structure of Bacillus subtilis BLAP biotinylated-form (energy minimized mean structure)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'minimized average' 
# 
_struct_keywords.entry_id        2B8G 
_struct_keywords.pdbx_keywords   'BIOSYNTHETIC PROTEIN' 
_struct_keywords.text            
'Bacillus subtilis, Single-domain Biotin Carboxyl Carrier Protein, solution structure, BIOSYNTHETIC PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9R9I3_BACSU 
_struct_ref.pdbx_db_accession          Q9R9I3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2B8G 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 72 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9R9I3 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  73 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       73 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        one 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           LYS 
_struct_conn.ptnr1_label_seq_id            34 
_struct_conn.ptnr1_label_atom_id           NZ 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           BTN 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           C11 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            LYS 
_struct_conn.ptnr1_auth_seq_id             35 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            BTN 
_struct_conn.ptnr2_auth_seq_id             135 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.340 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_modification_feature.ordinal                            1 
_pdbx_modification_feature.label_comp_id                      BTN 
_pdbx_modification_feature.label_asym_id                      B 
_pdbx_modification_feature.label_seq_id                       . 
_pdbx_modification_feature.label_alt_id                       ? 
_pdbx_modification_feature.modified_residue_label_comp_id     LYS 
_pdbx_modification_feature.modified_residue_label_asym_id     A 
_pdbx_modification_feature.modified_residue_label_seq_id      34 
_pdbx_modification_feature.modified_residue_label_alt_id      ? 
_pdbx_modification_feature.auth_comp_id                       BTN 
_pdbx_modification_feature.auth_asym_id                       A 
_pdbx_modification_feature.auth_seq_id                        135 
_pdbx_modification_feature.PDB_ins_code                       ? 
_pdbx_modification_feature.symmetry                           1_555 
_pdbx_modification_feature.modified_residue_auth_comp_id      LYS 
_pdbx_modification_feature.modified_residue_auth_asym_id      A 
_pdbx_modification_feature.modified_residue_auth_seq_id       35 
_pdbx_modification_feature.modified_residue_PDB_ins_code      ? 
_pdbx_modification_feature.modified_residue_symmetry          1_555 
_pdbx_modification_feature.comp_id_linking_atom               C11 
_pdbx_modification_feature.modified_residue_id_linking_atom   NZ 
_pdbx_modification_feature.modified_residue_id                LYS 
_pdbx_modification_feature.ref_pcm_id                         1 
_pdbx_modification_feature.ref_comp_id                        BTN 
_pdbx_modification_feature.type                               Biotinylation 
_pdbx_modification_feature.category                           Biotin 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 2  ? SER A 3  ? VAL A 3  SER A 4  
A 2 VAL A 63 ? LEU A 67 ? VAL A 64 LEU A 68 
A 3 GLY A 45 ? VAL A 50 ? GLY A 46 VAL A 51 
A 4 GLN A 20 ? ILE A 21 ? GLN A 21 ILE A 22 
B 1 MET A 35 ? VAL A 40 ? MET A 36 VAL A 41 
B 2 GLU A 26 ? SER A 32 ? GLU A 27 SER A 33 
B 3 GLY A 8  ? VAL A 13 ? GLY A 9  VAL A 14 
B 4 PHE A 57 ? VAL A 58 ? PHE A 58 VAL A 59 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 2  ? N VAL A 3  O LEU A 65 ? O LEU A 66 
A 2 3 O GLU A 66 ? O GLU A 67 N GLU A 49 ? N GLU A 50 
A 3 4 O GLY A 45 ? O GLY A 46 N ILE A 21 ? N ILE A 22 
B 1 2 O ILE A 39 ? O ILE A 40 N VAL A 27 ? N VAL A 28 
B 2 3 O GLU A 31 ? O GLU A 32 N ASN A 9  ? N ASN A 10 
B 3 4 N GLY A 8  ? N GLY A 9  O VAL A 58 ? O VAL A 59 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    BTN 
_struct_site.pdbx_auth_seq_id     135 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    2 
_struct_site.details              'BINDING SITE FOR RESIDUE BTN A 135' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 TRP A 11 ? TRP A 12 . ? 1_555 ? 
2 AC1 2 LYS A 34 ? LYS A 35 . ? 1_555 ? 
# 
_pdbx_entry_details.entry_id                   2B8G 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 35 ? ? 88.68   7.86   
2 1 LEU A 65 ? ? -133.35 -44.09 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 LEU A 31 ? ? GLU A 32 ? ? 135.22 
2 1 THR A 72 ? ? GLN A 73 ? ? 124.85 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     44 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.133 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
_pdbx_nmr_ensemble.entry_id                             2B8G 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_representative.entry_id             2B8G 
_pdbx_nmr_representative.conformer_id         ? 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1.2mM S-BCCP, U-15N,13C; 50mM phosphate buffer NA; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '150 mM' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY 1 
2 1 3D_15N-separated_NOESY 1 
3 1 '2D NOESY'             1 
# 
_pdbx_nmr_details.entry_id   2B8G 
_pdbx_nmr_details.text       'this structure was determined using standard 3D heternuclear techniques' 
# 
_pdbx_nmr_refine.entry_id           2B8G 
_pdbx_nmr_refine.method             'smulated annealing molecular dynamics' 
_pdbx_nmr_refine.details            
;the structures are based on a total of 4560 restraints. 4160 are NOE-derived   
distance constraints, 117 dihedral angle restraints,30 distance restraints from hydrogen bonds, 253 charity restraints
;
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XwinNMR 3.5   Bruker           1 
processing           NMRPipe 2.1   'Frank Delaglio' 2 
'data analysis'      NMRView 5     'Bruce Johnson'  3 
'structure solution' CYANA   1.0.6 'Peter Guntert'  4 
refinement           Amber   7.0   'David Case'     5 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
BTN C11  C N N 74  
BTN O11  O N N 75  
BTN O12  O N N 76  
BTN C10  C N N 77  
BTN C9   C N N 78  
BTN C8   C N N 79  
BTN C7   C N N 80  
BTN C2   C N S 81  
BTN S1   S N N 82  
BTN C6   C N N 83  
BTN C5   C N R 84  
BTN N1   N N N 85  
BTN C3   C N N 86  
BTN O3   O N N 87  
BTN N2   N N N 88  
BTN C4   C N S 89  
BTN HO2  H N N 90  
BTN H101 H N N 91  
BTN H102 H N N 92  
BTN H91  H N N 93  
BTN H92  H N N 94  
BTN H81  H N N 95  
BTN H82  H N N 96  
BTN H71  H N N 97  
BTN H72  H N N 98  
BTN H2   H N N 99  
BTN H61  H N N 100 
BTN H62  H N N 101 
BTN H5   H N N 102 
BTN HN1  H N N 103 
BTN HN2  H N N 104 
BTN H4   H N N 105 
GLN N    N N N 106 
GLN CA   C N S 107 
GLN C    C N N 108 
GLN O    O N N 109 
GLN CB   C N N 110 
GLN CG   C N N 111 
GLN CD   C N N 112 
GLN OE1  O N N 113 
GLN NE2  N N N 114 
GLN OXT  O N N 115 
GLN H    H N N 116 
GLN H2   H N N 117 
GLN HA   H N N 118 
GLN HB2  H N N 119 
GLN HB3  H N N 120 
GLN HG2  H N N 121 
GLN HG3  H N N 122 
GLN HE21 H N N 123 
GLN HE22 H N N 124 
GLN HXT  H N N 125 
GLU N    N N N 126 
GLU CA   C N S 127 
GLU C    C N N 128 
GLU O    O N N 129 
GLU CB   C N N 130 
GLU CG   C N N 131 
GLU CD   C N N 132 
GLU OE1  O N N 133 
GLU OE2  O N N 134 
GLU OXT  O N N 135 
GLU H    H N N 136 
GLU H2   H N N 137 
GLU HA   H N N 138 
GLU HB2  H N N 139 
GLU HB3  H N N 140 
GLU HG2  H N N 141 
GLU HG3  H N N 142 
GLU HE2  H N N 143 
GLU HXT  H N N 144 
GLY N    N N N 145 
GLY CA   C N N 146 
GLY C    C N N 147 
GLY O    O N N 148 
GLY OXT  O N N 149 
GLY H    H N N 150 
GLY H2   H N N 151 
GLY HA2  H N N 152 
GLY HA3  H N N 153 
GLY HXT  H N N 154 
HIS N    N N N 155 
HIS CA   C N S 156 
HIS C    C N N 157 
HIS O    O N N 158 
HIS CB   C N N 159 
HIS CG   C Y N 160 
HIS ND1  N Y N 161 
HIS CD2  C Y N 162 
HIS CE1  C Y N 163 
HIS NE2  N Y N 164 
HIS OXT  O N N 165 
HIS H    H N N 166 
HIS H2   H N N 167 
HIS HA   H N N 168 
HIS HB2  H N N 169 
HIS HB3  H N N 170 
HIS HD1  H N N 171 
HIS HD2  H N N 172 
HIS HE1  H N N 173 
HIS HE2  H N N 174 
HIS HXT  H N N 175 
ILE N    N N N 176 
ILE CA   C N S 177 
ILE C    C N N 178 
ILE O    O N N 179 
ILE CB   C N S 180 
ILE CG1  C N N 181 
ILE CG2  C N N 182 
ILE CD1  C N N 183 
ILE OXT  O N N 184 
ILE H    H N N 185 
ILE H2   H N N 186 
ILE HA   H N N 187 
ILE HB   H N N 188 
ILE HG12 H N N 189 
ILE HG13 H N N 190 
ILE HG21 H N N 191 
ILE HG22 H N N 192 
ILE HG23 H N N 193 
ILE HD11 H N N 194 
ILE HD12 H N N 195 
ILE HD13 H N N 196 
ILE HXT  H N N 197 
LEU N    N N N 198 
LEU CA   C N S 199 
LEU C    C N N 200 
LEU O    O N N 201 
LEU CB   C N N 202 
LEU CG   C N N 203 
LEU CD1  C N N 204 
LEU CD2  C N N 205 
LEU OXT  O N N 206 
LEU H    H N N 207 
LEU H2   H N N 208 
LEU HA   H N N 209 
LEU HB2  H N N 210 
LEU HB3  H N N 211 
LEU HG   H N N 212 
LEU HD11 H N N 213 
LEU HD12 H N N 214 
LEU HD13 H N N 215 
LEU HD21 H N N 216 
LEU HD22 H N N 217 
LEU HD23 H N N 218 
LEU HXT  H N N 219 
LYS N    N N N 220 
LYS CA   C N S 221 
LYS C    C N N 222 
LYS O    O N N 223 
LYS CB   C N N 224 
LYS CG   C N N 225 
LYS CD   C N N 226 
LYS CE   C N N 227 
LYS NZ   N N N 228 
LYS OXT  O N N 229 
LYS H    H N N 230 
LYS H2   H N N 231 
LYS HA   H N N 232 
LYS HB2  H N N 233 
LYS HB3  H N N 234 
LYS HG2  H N N 235 
LYS HG3  H N N 236 
LYS HD2  H N N 237 
LYS HD3  H N N 238 
LYS HE2  H N N 239 
LYS HE3  H N N 240 
LYS HZ1  H N N 241 
LYS HZ2  H N N 242 
LYS HZ3  H N N 243 
LYS HXT  H N N 244 
MET N    N N N 245 
MET CA   C N S 246 
MET C    C N N 247 
MET O    O N N 248 
MET CB   C N N 249 
MET CG   C N N 250 
MET SD   S N N 251 
MET CE   C N N 252 
MET OXT  O N N 253 
MET H    H N N 254 
MET H2   H N N 255 
MET HA   H N N 256 
MET HB2  H N N 257 
MET HB3  H N N 258 
MET HG2  H N N 259 
MET HG3  H N N 260 
MET HE1  H N N 261 
MET HE2  H N N 262 
MET HE3  H N N 263 
MET HXT  H N N 264 
PHE N    N N N 265 
PHE CA   C N S 266 
PHE C    C N N 267 
PHE O    O N N 268 
PHE CB   C N N 269 
PHE CG   C Y N 270 
PHE CD1  C Y N 271 
PHE CD2  C Y N 272 
PHE CE1  C Y N 273 
PHE CE2  C Y N 274 
PHE CZ   C Y N 275 
PHE OXT  O N N 276 
PHE H    H N N 277 
PHE H2   H N N 278 
PHE HA   H N N 279 
PHE HB2  H N N 280 
PHE HB3  H N N 281 
PHE HD1  H N N 282 
PHE HD2  H N N 283 
PHE HE1  H N N 284 
PHE HE2  H N N 285 
PHE HZ   H N N 286 
PHE HXT  H N N 287 
PRO N    N N N 288 
PRO CA   C N S 289 
PRO C    C N N 290 
PRO O    O N N 291 
PRO CB   C N N 292 
PRO CG   C N N 293 
PRO CD   C N N 294 
PRO OXT  O N N 295 
PRO H    H N N 296 
PRO HA   H N N 297 
PRO HB2  H N N 298 
PRO HB3  H N N 299 
PRO HG2  H N N 300 
PRO HG3  H N N 301 
PRO HD2  H N N 302 
PRO HD3  H N N 303 
PRO HXT  H N N 304 
SER N    N N N 305 
SER CA   C N S 306 
SER C    C N N 307 
SER O    O N N 308 
SER CB   C N N 309 
SER OG   O N N 310 
SER OXT  O N N 311 
SER H    H N N 312 
SER H2   H N N 313 
SER HA   H N N 314 
SER HB2  H N N 315 
SER HB3  H N N 316 
SER HG   H N N 317 
SER HXT  H N N 318 
THR N    N N N 319 
THR CA   C N S 320 
THR C    C N N 321 
THR O    O N N 322 
THR CB   C N R 323 
THR OG1  O N N 324 
THR CG2  C N N 325 
THR OXT  O N N 326 
THR H    H N N 327 
THR H2   H N N 328 
THR HA   H N N 329 
THR HB   H N N 330 
THR HG1  H N N 331 
THR HG21 H N N 332 
THR HG22 H N N 333 
THR HG23 H N N 334 
THR HXT  H N N 335 
TRP N    N N N 336 
TRP CA   C N S 337 
TRP C    C N N 338 
TRP O    O N N 339 
TRP CB   C N N 340 
TRP CG   C Y N 341 
TRP CD1  C Y N 342 
TRP CD2  C Y N 343 
TRP NE1  N Y N 344 
TRP CE2  C Y N 345 
TRP CE3  C Y N 346 
TRP CZ2  C Y N 347 
TRP CZ3  C Y N 348 
TRP CH2  C Y N 349 
TRP OXT  O N N 350 
TRP H    H N N 351 
TRP H2   H N N 352 
TRP HA   H N N 353 
TRP HB2  H N N 354 
TRP HB3  H N N 355 
TRP HD1  H N N 356 
TRP HE1  H N N 357 
TRP HE3  H N N 358 
TRP HZ2  H N N 359 
TRP HZ3  H N N 360 
TRP HH2  H N N 361 
TRP HXT  H N N 362 
VAL N    N N N 363 
VAL CA   C N S 364 
VAL C    C N N 365 
VAL O    O N N 366 
VAL CB   C N N 367 
VAL CG1  C N N 368 
VAL CG2  C N N 369 
VAL OXT  O N N 370 
VAL H    H N N 371 
VAL H2   H N N 372 
VAL HA   H N N 373 
VAL HB   H N N 374 
VAL HG11 H N N 375 
VAL HG12 H N N 376 
VAL HG13 H N N 377 
VAL HG21 H N N 378 
VAL HG22 H N N 379 
VAL HG23 H N N 380 
VAL HXT  H N N 381 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
BTN C11 O11  doub N N 70  
BTN C11 O12  sing N N 71  
BTN C11 C10  sing N N 72  
BTN O12 HO2  sing N N 73  
BTN C10 C9   sing N N 74  
BTN C10 H101 sing N N 75  
BTN C10 H102 sing N N 76  
BTN C9  C8   sing N N 77  
BTN C9  H91  sing N N 78  
BTN C9  H92  sing N N 79  
BTN C8  C7   sing N N 80  
BTN C8  H81  sing N N 81  
BTN C8  H82  sing N N 82  
BTN C7  C2   sing N N 83  
BTN C7  H71  sing N N 84  
BTN C7  H72  sing N N 85  
BTN C2  S1   sing N N 86  
BTN C2  C4   sing N N 87  
BTN C2  H2   sing N N 88  
BTN S1  C6   sing N N 89  
BTN C6  C5   sing N N 90  
BTN C6  H61  sing N N 91  
BTN C6  H62  sing N N 92  
BTN C5  N1   sing N N 93  
BTN C5  C4   sing N N 94  
BTN C5  H5   sing N N 95  
BTN N1  C3   sing N N 96  
BTN N1  HN1  sing N N 97  
BTN C3  O3   doub N N 98  
BTN C3  N2   sing N N 99  
BTN N2  C4   sing N N 100 
BTN N2  HN2  sing N N 101 
BTN C4  H4   sing N N 102 
GLN N   CA   sing N N 103 
GLN N   H    sing N N 104 
GLN N   H2   sing N N 105 
GLN CA  C    sing N N 106 
GLN CA  CB   sing N N 107 
GLN CA  HA   sing N N 108 
GLN C   O    doub N N 109 
GLN C   OXT  sing N N 110 
GLN CB  CG   sing N N 111 
GLN CB  HB2  sing N N 112 
GLN CB  HB3  sing N N 113 
GLN CG  CD   sing N N 114 
GLN CG  HG2  sing N N 115 
GLN CG  HG3  sing N N 116 
GLN CD  OE1  doub N N 117 
GLN CD  NE2  sing N N 118 
GLN NE2 HE21 sing N N 119 
GLN NE2 HE22 sing N N 120 
GLN OXT HXT  sing N N 121 
GLU N   CA   sing N N 122 
GLU N   H    sing N N 123 
GLU N   H2   sing N N 124 
GLU CA  C    sing N N 125 
GLU CA  CB   sing N N 126 
GLU CA  HA   sing N N 127 
GLU C   O    doub N N 128 
GLU C   OXT  sing N N 129 
GLU CB  CG   sing N N 130 
GLU CB  HB2  sing N N 131 
GLU CB  HB3  sing N N 132 
GLU CG  CD   sing N N 133 
GLU CG  HG2  sing N N 134 
GLU CG  HG3  sing N N 135 
GLU CD  OE1  doub N N 136 
GLU CD  OE2  sing N N 137 
GLU OE2 HE2  sing N N 138 
GLU OXT HXT  sing N N 139 
GLY N   CA   sing N N 140 
GLY N   H    sing N N 141 
GLY N   H2   sing N N 142 
GLY CA  C    sing N N 143 
GLY CA  HA2  sing N N 144 
GLY CA  HA3  sing N N 145 
GLY C   O    doub N N 146 
GLY C   OXT  sing N N 147 
GLY OXT HXT  sing N N 148 
HIS N   CA   sing N N 149 
HIS N   H    sing N N 150 
HIS N   H2   sing N N 151 
HIS CA  C    sing N N 152 
HIS CA  CB   sing N N 153 
HIS CA  HA   sing N N 154 
HIS C   O    doub N N 155 
HIS C   OXT  sing N N 156 
HIS CB  CG   sing N N 157 
HIS CB  HB2  sing N N 158 
HIS CB  HB3  sing N N 159 
HIS CG  ND1  sing Y N 160 
HIS CG  CD2  doub Y N 161 
HIS ND1 CE1  doub Y N 162 
HIS ND1 HD1  sing N N 163 
HIS CD2 NE2  sing Y N 164 
HIS CD2 HD2  sing N N 165 
HIS CE1 NE2  sing Y N 166 
HIS CE1 HE1  sing N N 167 
HIS NE2 HE2  sing N N 168 
HIS OXT HXT  sing N N 169 
ILE N   CA   sing N N 170 
ILE N   H    sing N N 171 
ILE N   H2   sing N N 172 
ILE CA  C    sing N N 173 
ILE CA  CB   sing N N 174 
ILE CA  HA   sing N N 175 
ILE C   O    doub N N 176 
ILE C   OXT  sing N N 177 
ILE CB  CG1  sing N N 178 
ILE CB  CG2  sing N N 179 
ILE CB  HB   sing N N 180 
ILE CG1 CD1  sing N N 181 
ILE CG1 HG12 sing N N 182 
ILE CG1 HG13 sing N N 183 
ILE CG2 HG21 sing N N 184 
ILE CG2 HG22 sing N N 185 
ILE CG2 HG23 sing N N 186 
ILE CD1 HD11 sing N N 187 
ILE CD1 HD12 sing N N 188 
ILE CD1 HD13 sing N N 189 
ILE OXT HXT  sing N N 190 
LEU N   CA   sing N N 191 
LEU N   H    sing N N 192 
LEU N   H2   sing N N 193 
LEU CA  C    sing N N 194 
LEU CA  CB   sing N N 195 
LEU CA  HA   sing N N 196 
LEU C   O    doub N N 197 
LEU C   OXT  sing N N 198 
LEU CB  CG   sing N N 199 
LEU CB  HB2  sing N N 200 
LEU CB  HB3  sing N N 201 
LEU CG  CD1  sing N N 202 
LEU CG  CD2  sing N N 203 
LEU CG  HG   sing N N 204 
LEU CD1 HD11 sing N N 205 
LEU CD1 HD12 sing N N 206 
LEU CD1 HD13 sing N N 207 
LEU CD2 HD21 sing N N 208 
LEU CD2 HD22 sing N N 209 
LEU CD2 HD23 sing N N 210 
LEU OXT HXT  sing N N 211 
LYS N   CA   sing N N 212 
LYS N   H    sing N N 213 
LYS N   H2   sing N N 214 
LYS CA  C    sing N N 215 
LYS CA  CB   sing N N 216 
LYS CA  HA   sing N N 217 
LYS C   O    doub N N 218 
LYS C   OXT  sing N N 219 
LYS CB  CG   sing N N 220 
LYS CB  HB2  sing N N 221 
LYS CB  HB3  sing N N 222 
LYS CG  CD   sing N N 223 
LYS CG  HG2  sing N N 224 
LYS CG  HG3  sing N N 225 
LYS CD  CE   sing N N 226 
LYS CD  HD2  sing N N 227 
LYS CD  HD3  sing N N 228 
LYS CE  NZ   sing N N 229 
LYS CE  HE2  sing N N 230 
LYS CE  HE3  sing N N 231 
LYS NZ  HZ1  sing N N 232 
LYS NZ  HZ2  sing N N 233 
LYS NZ  HZ3  sing N N 234 
LYS OXT HXT  sing N N 235 
MET N   CA   sing N N 236 
MET N   H    sing N N 237 
MET N   H2   sing N N 238 
MET CA  C    sing N N 239 
MET CA  CB   sing N N 240 
MET CA  HA   sing N N 241 
MET C   O    doub N N 242 
MET C   OXT  sing N N 243 
MET CB  CG   sing N N 244 
MET CB  HB2  sing N N 245 
MET CB  HB3  sing N N 246 
MET CG  SD   sing N N 247 
MET CG  HG2  sing N N 248 
MET CG  HG3  sing N N 249 
MET SD  CE   sing N N 250 
MET CE  HE1  sing N N 251 
MET CE  HE2  sing N N 252 
MET CE  HE3  sing N N 253 
MET OXT HXT  sing N N 254 
PHE N   CA   sing N N 255 
PHE N   H    sing N N 256 
PHE N   H2   sing N N 257 
PHE CA  C    sing N N 258 
PHE CA  CB   sing N N 259 
PHE CA  HA   sing N N 260 
PHE C   O    doub N N 261 
PHE C   OXT  sing N N 262 
PHE CB  CG   sing N N 263 
PHE CB  HB2  sing N N 264 
PHE CB  HB3  sing N N 265 
PHE CG  CD1  doub Y N 266 
PHE CG  CD2  sing Y N 267 
PHE CD1 CE1  sing Y N 268 
PHE CD1 HD1  sing N N 269 
PHE CD2 CE2  doub Y N 270 
PHE CD2 HD2  sing N N 271 
PHE CE1 CZ   doub Y N 272 
PHE CE1 HE1  sing N N 273 
PHE CE2 CZ   sing Y N 274 
PHE CE2 HE2  sing N N 275 
PHE CZ  HZ   sing N N 276 
PHE OXT HXT  sing N N 277 
PRO N   CA   sing N N 278 
PRO N   CD   sing N N 279 
PRO N   H    sing N N 280 
PRO CA  C    sing N N 281 
PRO CA  CB   sing N N 282 
PRO CA  HA   sing N N 283 
PRO C   O    doub N N 284 
PRO C   OXT  sing N N 285 
PRO CB  CG   sing N N 286 
PRO CB  HB2  sing N N 287 
PRO CB  HB3  sing N N 288 
PRO CG  CD   sing N N 289 
PRO CG  HG2  sing N N 290 
PRO CG  HG3  sing N N 291 
PRO CD  HD2  sing N N 292 
PRO CD  HD3  sing N N 293 
PRO OXT HXT  sing N N 294 
SER N   CA   sing N N 295 
SER N   H    sing N N 296 
SER N   H2   sing N N 297 
SER CA  C    sing N N 298 
SER CA  CB   sing N N 299 
SER CA  HA   sing N N 300 
SER C   O    doub N N 301 
SER C   OXT  sing N N 302 
SER CB  OG   sing N N 303 
SER CB  HB2  sing N N 304 
SER CB  HB3  sing N N 305 
SER OG  HG   sing N N 306 
SER OXT HXT  sing N N 307 
THR N   CA   sing N N 308 
THR N   H    sing N N 309 
THR N   H2   sing N N 310 
THR CA  C    sing N N 311 
THR CA  CB   sing N N 312 
THR CA  HA   sing N N 313 
THR C   O    doub N N 314 
THR C   OXT  sing N N 315 
THR CB  OG1  sing N N 316 
THR CB  CG2  sing N N 317 
THR CB  HB   sing N N 318 
THR OG1 HG1  sing N N 319 
THR CG2 HG21 sing N N 320 
THR CG2 HG22 sing N N 321 
THR CG2 HG23 sing N N 322 
THR OXT HXT  sing N N 323 
TRP N   CA   sing N N 324 
TRP N   H    sing N N 325 
TRP N   H2   sing N N 326 
TRP CA  C    sing N N 327 
TRP CA  CB   sing N N 328 
TRP CA  HA   sing N N 329 
TRP C   O    doub N N 330 
TRP C   OXT  sing N N 331 
TRP CB  CG   sing N N 332 
TRP CB  HB2  sing N N 333 
TRP CB  HB3  sing N N 334 
TRP CG  CD1  doub Y N 335 
TRP CG  CD2  sing Y N 336 
TRP CD1 NE1  sing Y N 337 
TRP CD1 HD1  sing N N 338 
TRP CD2 CE2  doub Y N 339 
TRP CD2 CE3  sing Y N 340 
TRP NE1 CE2  sing Y N 341 
TRP NE1 HE1  sing N N 342 
TRP CE2 CZ2  sing Y N 343 
TRP CE3 CZ3  doub Y N 344 
TRP CE3 HE3  sing N N 345 
TRP CZ2 CH2  doub Y N 346 
TRP CZ2 HZ2  sing N N 347 
TRP CZ3 CH2  sing Y N 348 
TRP CZ3 HZ3  sing N N 349 
TRP CH2 HH2  sing N N 350 
TRP OXT HXT  sing N N 351 
VAL N   CA   sing N N 352 
VAL N   H    sing N N 353 
VAL N   H2   sing N N 354 
VAL CA  C    sing N N 355 
VAL CA  CB   sing N N 356 
VAL CA  HA   sing N N 357 
VAL C   O    doub N N 358 
VAL C   OXT  sing N N 359 
VAL CB  CG1  sing N N 360 
VAL CB  CG2  sing N N 361 
VAL CB  HB   sing N N 362 
VAL CG1 HG11 sing N N 363 
VAL CG1 HG12 sing N N 364 
VAL CG1 HG13 sing N N 365 
VAL CG2 HG21 sing N N 366 
VAL CG2 HG22 sing N N 367 
VAL CG2 HG23 sing N N 368 
VAL OXT HXT  sing N N 369 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             AVANCE 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.type              ? 
# 
_atom_sites.entry_id                    2B8G 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_