data_2C2J # _entry.id 2C2J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2C2J PDBE EBI-25621 WWPDB D_1290025621 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2C6R _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'FE-SOAKED CRYSTAL STRUCTURE OF THE DPS92 FROM DEINOCOCCUS RADIODURANS' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2C2J _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2005-09-29 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cuypers, M.G.' 1 'Romao, C.V.' 2 'Mitchell, E.' 3 'McSweeney, S.' 4 # _citation.id primary _citation.title ;The Crystal Structure of the Dps2 from Deinococcus Radiodurans Reveals an Unusual Pore Profile with a Non-Specific Metal Binding Site. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 371 _citation.page_first 787 _citation.page_last ? _citation.year 2007 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17583727 _citation.pdbx_database_id_DOI 10.1016/J.JMB.2006.11.032 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Cuypers, M.G.' 1 primary 'Mitchell, E.P.' 2 primary 'Romao, C.V.' 3 primary 'Mcsweeney, S.M.' 4 # _cell.entry_id 2C2J _cell.length_a 88.453 _cell.length_b 88.453 _cell.length_c 88.453 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2C2J _symmetry.space_group_name_H-M 'P 2 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 195 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA-BINDING STRESS RESPONSE PROTEIN' 23289.715 1 ? ? ? 'DRB0092 WAS TRUNCATED - RESIDUE NUMBERING STARTS AFTER N-TERMINAL RESIDUE NUMBER 30' 2 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 128 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DRDPS92, DPS FAMILY' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;NGVPSTNVNTPAPNTGQSTAQNTNTASPLPYNRATTLPAAGTEDLKKSVQALQNTLTELQALQLQTKQAHWNVSGTLWYT LHELLQDHYEGISKFADDVAERQLSVGASSDGRAITIVAASRLPEIPGGFLDDAQVIQFFTYQYETVGQRIHQRVGDVEK VDPTTANLLQEVEHIIEKYQWQMRAFLQNTPTDPNTGFDINNGKPVPLRGR ; _entity_poly.pdbx_seq_one_letter_code_can ;NGVPSTNVNTPAPNTGQSTAQNTNTASPLPYNRATTLPAAGTEDLKKSVQALQNTLTELQALQLQTKQAHWNVSGTLWYT LHELLQDHYEGISKFADDVAERQLSVGASSDGRAITIVAASRLPEIPGGFLDDAQVIQFFTYQYETVGQRIHQRVGDVEK VDPTTANLLQEVEHIIEKYQWQMRAFLQNTPTDPNTGFDINNGKPVPLRGR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 GLY n 1 3 VAL n 1 4 PRO n 1 5 SER n 1 6 THR n 1 7 ASN n 1 8 VAL n 1 9 ASN n 1 10 THR n 1 11 PRO n 1 12 ALA n 1 13 PRO n 1 14 ASN n 1 15 THR n 1 16 GLY n 1 17 GLN n 1 18 SER n 1 19 THR n 1 20 ALA n 1 21 GLN n 1 22 ASN n 1 23 THR n 1 24 ASN n 1 25 THR n 1 26 ALA n 1 27 SER n 1 28 PRO n 1 29 LEU n 1 30 PRO n 1 31 TYR n 1 32 ASN n 1 33 ARG n 1 34 ALA n 1 35 THR n 1 36 THR n 1 37 LEU n 1 38 PRO n 1 39 ALA n 1 40 ALA n 1 41 GLY n 1 42 THR n 1 43 GLU n 1 44 ASP n 1 45 LEU n 1 46 LYS n 1 47 LYS n 1 48 SER n 1 49 VAL n 1 50 GLN n 1 51 ALA n 1 52 LEU n 1 53 GLN n 1 54 ASN n 1 55 THR n 1 56 LEU n 1 57 THR n 1 58 GLU n 1 59 LEU n 1 60 GLN n 1 61 ALA n 1 62 LEU n 1 63 GLN n 1 64 LEU n 1 65 GLN n 1 66 THR n 1 67 LYS n 1 68 GLN n 1 69 ALA n 1 70 HIS n 1 71 TRP n 1 72 ASN n 1 73 VAL n 1 74 SER n 1 75 GLY n 1 76 THR n 1 77 LEU n 1 78 TRP n 1 79 TYR n 1 80 THR n 1 81 LEU n 1 82 HIS n 1 83 GLU n 1 84 LEU n 1 85 LEU n 1 86 GLN n 1 87 ASP n 1 88 HIS n 1 89 TYR n 1 90 GLU n 1 91 GLY n 1 92 ILE n 1 93 SER n 1 94 LYS n 1 95 PHE n 1 96 ALA n 1 97 ASP n 1 98 ASP n 1 99 VAL n 1 100 ALA n 1 101 GLU n 1 102 ARG n 1 103 GLN n 1 104 LEU n 1 105 SER n 1 106 VAL n 1 107 GLY n 1 108 ALA n 1 109 SER n 1 110 SER n 1 111 ASP n 1 112 GLY n 1 113 ARG n 1 114 ALA n 1 115 ILE n 1 116 THR n 1 117 ILE n 1 118 VAL n 1 119 ALA n 1 120 ALA n 1 121 SER n 1 122 ARG n 1 123 LEU n 1 124 PRO n 1 125 GLU n 1 126 ILE n 1 127 PRO n 1 128 GLY n 1 129 GLY n 1 130 PHE n 1 131 LEU n 1 132 ASP n 1 133 ASP n 1 134 ALA n 1 135 GLN n 1 136 VAL n 1 137 ILE n 1 138 GLN n 1 139 PHE n 1 140 PHE n 1 141 THR n 1 142 TYR n 1 143 GLN n 1 144 TYR n 1 145 GLU n 1 146 THR n 1 147 VAL n 1 148 GLY n 1 149 GLN n 1 150 ARG n 1 151 ILE n 1 152 HIS n 1 153 GLN n 1 154 ARG n 1 155 VAL n 1 156 GLY n 1 157 ASP n 1 158 VAL n 1 159 GLU n 1 160 LYS n 1 161 VAL n 1 162 ASP n 1 163 PRO n 1 164 THR n 1 165 THR n 1 166 ALA n 1 167 ASN n 1 168 LEU n 1 169 LEU n 1 170 GLN n 1 171 GLU n 1 172 VAL n 1 173 GLU n 1 174 HIS n 1 175 ILE n 1 176 ILE n 1 177 GLU n 1 178 LYS n 1 179 TYR n 1 180 GLN n 1 181 TRP n 1 182 GLN n 1 183 MET n 1 184 ARG n 1 185 ALA n 1 186 PHE n 1 187 LEU n 1 188 GLN n 1 189 ASN n 1 190 THR n 1 191 PRO n 1 192 THR n 1 193 ASP n 1 194 PRO n 1 195 ASN n 1 196 THR n 1 197 GLY n 1 198 PHE n 1 199 ASP n 1 200 ILE n 1 201 ASN n 1 202 ASN n 1 203 GLY n 1 204 LYS n 1 205 PRO n 1 206 VAL n 1 207 PRO n 1 208 LEU n 1 209 ARG n 1 210 GLY n 1 211 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain R1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'DEINOCOCCUS RADIODURANS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 243230 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PDEST14 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9RZN1_DEIRA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q9RZN1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2C2J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 211 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9RZN1 _struct_ref_seq.db_align_beg 31 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 241 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 211 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2C2J _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.5 _exptl_crystal.density_percent_sol 54.3 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.50 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.01M MGCL2, 0.05M TRIS-HCL PH 7.5, 5% ISOPROPANOL' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC MARRESEARCH' _diffrn_detector.pdbx_collection_date 2005-03-21 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.93300 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-2' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-2 _diffrn_source.pdbx_wavelength 0.93300 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2C2J _reflns.observed_criterion_sigma_I 1.500 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 44.200 _reflns.d_resolution_high 2.050 _reflns.number_obs 14773 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs 0.07000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 40.4000 _reflns.B_iso_Wilson_estimate 29.80 _reflns.pdbx_redundancy 21.100 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.05 _reflns_shell.d_res_low 2.10 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.50000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.600 _reflns_shell.pdbx_redundancy 18.60 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2C2J _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 14753 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 88.74 _refine.ls_d_res_high 2.05 _refine.ls_percent_reflns_obs 100.0 _refine.ls_R_factor_obs 0.179 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.179 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.958 _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 31.91 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. THE 41 N-TERMINAL AND 5 C-TERMINAL RESIDUES ARE MISSING IN THE STRUCTURE. WATERS 22, 31, 43 AND 126 HAVE OCCUPANCIES BELOW 1 BECAUSE OF THEIR LOCALISATION ON SYMMETRY AXIS. Z22 LIES ON A CELL EDGE AND A 2 FOLD AXIS Z43 LIES ON A CELL EDGE AND A 2 FOLD AXIS Z126 LIES ON A 3 FOLD AXIS ; _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.147 _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.073 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 2.587 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1318 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 128 _refine_hist.number_atoms_total 1448 _refine_hist.d_res_high 2.05 _refine_hist.d_res_low 88.74 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.018 0.022 ? 1345 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.383 1.936 ? 1831 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 4.847 5.000 ? 164 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 42.509 25.634 ? 71 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.177 15.000 ? 225 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 31.898 15.000 ? 6 'X-RAY DIFFRACTION' ? r_chiral_restr 0.103 0.200 ? 206 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 1040 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.219 0.200 ? 646 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.299 0.200 ? 956 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.167 0.200 ? 116 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.197 0.200 ? 64 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.375 0.200 ? 25 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.181 1.500 ? 846 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.813 2.000 ? 1330 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 2.746 3.000 ? 570 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 4.160 4.500 ? 501 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.05 _refine_ls_shell.d_res_low 2.10 _refine_ls_shell.number_reflns_R_work 1078 _refine_ls_shell.R_factor_R_work 0.2020 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.2550 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2C2J _struct.title 'Crystal Structure Of The Dps92 From Deinococcus Radiodurans' _struct.pdbx_descriptor 'DNA-BINDING STRESS RESPONSE PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2C2J _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'DNA-BINDING PROTEIN, DPS, DEINOCOCCUS, RADIODURANS, DNA-BINDING, DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 42 ? ASN A 72 ? THR A 42 ASN A 72 1 ? 31 HELX_P HELX_P2 2 LEU A 77 ? VAL A 106 ? LEU A 77 VAL A 106 1 ? 30 HELX_P HELX_P3 3 ARG A 113 ? ALA A 120 ? ARG A 113 ALA A 120 1 ? 8 HELX_P HELX_P4 4 ASP A 133 ? GLU A 159 ? ASP A 133 GLU A 159 1 ? 27 HELX_P HELX_P5 5 ASP A 162 ? GLN A 188 ? ASP A 162 GLN A 188 1 ? 27 HELX_P HELX_P6 7 GLY A 197 ? ASN A 201 ? GLY A 197 ASN A 201 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B FE . FE ? ? ? 1_555 A GLU 171 OE2 ? ? A FE 1210 A GLU 171 1_555 ? ? ? ? ? ? ? 2.604 ? metalc2 metalc ? ? B FE . FE ? ? ? 1_555 A GLU 171 OE2 ? ? A FE 1210 A GLU 171 10_656 ? ? ? ? ? ? ? 2.649 ? metalc3 metalc ? ? B FE . FE ? ? ? 1_555 A GLU 171 OE2 ? ? A FE 1210 A GLU 171 7_665 ? ? ? ? ? ? ? 2.631 ? metalc4 metalc ? ? C MG . MG ? ? ? 1_555 A ASP 193 OD2 ? ? A MG 1213 A ASP 193 12_654 ? ? ? ? ? ? ? 2.473 ? metalc5 metalc ? ? C MG . MG ? ? ? 1_555 A ASN 195 OD1 ? ? A MG 1213 A ASN 195 12_654 ? ? ? ? ? ? ? 2.319 ? metalc6 metalc ? ? C MG . MG ? ? ? 1_555 A ASP 132 OD2 ? ? A MG 1213 A ASP 132 1_555 ? ? ? ? ? ? ? 2.536 ? metalc7 metalc ? ? C MG . MG ? ? ? 1_555 A ASP 133 OD1 ? ? A MG 1213 A ASP 133 1_555 ? ? ? ? ? ? ? 2.439 ? metalc8 metalc ? ? C MG . MG ? ? ? 1_555 A ILE 200 O ? ? A MG 1213 A ILE 200 1_555 ? ? ? ? ? ? ? 2.349 ? metalc9 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 1213 A HOH 2084 1_555 ? ? ? ? ? ? ? 2.438 ? metalc10 metalc ? ? C MG . MG ? ? ? 1_555 A ASP 132 OD1 ? ? A MG 1213 A ASP 132 1_555 ? ? ? ? ? ? ? 2.184 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 VAL A 73 ? SER A 74 ? VAL A 73 SER A 74 AA 2 LEU A 131 ? ASP A 132 ? LEU A 131 ASP A 132 # _pdbx_struct_sheet_hbond.sheet_id AA _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id SER _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 74 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id SER _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 74 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 131 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 131 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE FE A1210' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A1213' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 GLU A 171 ? GLU A 171 . ? 1_555 ? 2 AC2 6 ASP A 132 ? ASP A 132 . ? 1_555 ? 3 AC2 6 ASP A 133 ? ASP A 133 . ? 1_555 ? 4 AC2 6 ASP A 193 ? ASP A 193 . ? 1_555 ? 5 AC2 6 ASN A 195 ? ASN A 195 . ? 1_555 ? 6 AC2 6 ILE A 200 ? ILE A 200 . ? 1_555 ? 7 AC2 6 HOH D . ? HOH A 2084 . ? 1_555 ? # _database_PDB_matrix.entry_id 2C2J _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2C2J _atom_sites.fract_transf_matrix[1][1] 0.011305 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011305 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011305 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 VAL 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 THR 6 6 ? ? ? A . n A 1 7 ASN 7 7 ? ? ? A . n A 1 8 VAL 8 8 ? ? ? A . n A 1 9 ASN 9 9 ? ? ? A . n A 1 10 THR 10 10 ? ? ? A . n A 1 11 PRO 11 11 ? ? ? A . n A 1 12 ALA 12 12 ? ? ? A . n A 1 13 PRO 13 13 ? ? ? A . n A 1 14 ASN 14 14 ? ? ? A . n A 1 15 THR 15 15 ? ? ? A . n A 1 16 GLY 16 16 ? ? ? A . n A 1 17 GLN 17 17 ? ? ? A . n A 1 18 SER 18 18 ? ? ? A . n A 1 19 THR 19 19 ? ? ? A . n A 1 20 ALA 20 20 ? ? ? A . n A 1 21 GLN 21 21 ? ? ? A . n A 1 22 ASN 22 22 ? ? ? A . n A 1 23 THR 23 23 ? ? ? A . n A 1 24 ASN 24 24 ? ? ? A . n A 1 25 THR 25 25 ? ? ? A . n A 1 26 ALA 26 26 ? ? ? A . n A 1 27 SER 27 27 ? ? ? A . n A 1 28 PRO 28 28 ? ? ? A . n A 1 29 LEU 29 29 ? ? ? A . n A 1 30 PRO 30 30 ? ? ? A . n A 1 31 TYR 31 31 ? ? ? A . n A 1 32 ASN 32 32 ? ? ? A . n A 1 33 ARG 33 33 ? ? ? A . n A 1 34 ALA 34 34 ? ? ? A . n A 1 35 THR 35 35 ? ? ? A . n A 1 36 THR 36 36 ? ? ? A . n A 1 37 LEU 37 37 ? ? ? A . n A 1 38 PRO 38 38 ? ? ? A . n A 1 39 ALA 39 39 ? ? ? A . n A 1 40 ALA 40 40 ? ? ? A . n A 1 41 GLY 41 41 ? ? ? A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 TRP 71 71 71 TRP TRP A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 GLN 135 135 135 GLN GLN A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 TYR 142 142 142 TYR TYR A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 TYR 144 144 144 TYR TYR A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 HIS 152 152 152 HIS HIS A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 ASN 167 167 167 ASN ASN A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 GLN 170 170 170 GLN GLN A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 HIS 174 174 174 HIS HIS A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 TYR 179 179 179 TYR TYR A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 TRP 181 181 181 TRP TRP A . n A 1 182 GLN 182 182 182 GLN GLN A . n A 1 183 MET 183 183 183 MET MET A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 PHE 186 186 186 PHE PHE A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 GLN 188 188 188 GLN GLN A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 THR 192 192 192 THR THR A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 ASN 195 195 195 ASN ASN A . n A 1 196 THR 196 196 196 THR THR A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 PHE 198 198 198 PHE PHE A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 ASN 201 201 201 ASN ASN A . n A 1 202 ASN 202 202 202 ASN ASN A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 LYS 204 204 204 LYS LYS A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 PRO 207 207 207 PRO PRO A . n A 1 208 LEU 208 208 ? ? ? A . n A 1 209 ARG 209 209 ? ? ? A . n A 1 210 GLY 210 210 ? ? ? A . n A 1 211 ARG 211 211 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE 1 1210 1210 FE FE A . C 3 MG 1 1213 1213 MG MG A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . D 4 HOH 66 2066 2066 HOH HOH A . D 4 HOH 67 2067 2067 HOH HOH A . D 4 HOH 68 2068 2068 HOH HOH A . D 4 HOH 69 2069 2069 HOH HOH A . D 4 HOH 70 2070 2070 HOH HOH A . D 4 HOH 71 2071 2071 HOH HOH A . D 4 HOH 72 2072 2072 HOH HOH A . D 4 HOH 73 2073 2073 HOH HOH A . D 4 HOH 74 2074 2074 HOH HOH A . D 4 HOH 75 2075 2075 HOH HOH A . D 4 HOH 76 2076 2076 HOH HOH A . D 4 HOH 77 2077 2077 HOH HOH A . D 4 HOH 78 2078 2078 HOH HOH A . D 4 HOH 79 2079 2079 HOH HOH A . D 4 HOH 80 2080 2080 HOH HOH A . D 4 HOH 81 2081 2081 HOH HOH A . D 4 HOH 82 2082 2082 HOH HOH A . D 4 HOH 83 2083 2083 HOH HOH A . D 4 HOH 84 2084 2084 HOH HOH A . D 4 HOH 85 2085 2085 HOH HOH A . D 4 HOH 86 2086 2086 HOH HOH A . D 4 HOH 87 2087 2087 HOH HOH A . D 4 HOH 88 2088 2088 HOH HOH A . D 4 HOH 89 2089 2089 HOH HOH A . D 4 HOH 90 2090 2090 HOH HOH A . D 4 HOH 91 2091 2091 HOH HOH A . D 4 HOH 92 2092 2092 HOH HOH A . D 4 HOH 93 2093 2093 HOH HOH A . D 4 HOH 94 2094 2094 HOH HOH A . D 4 HOH 95 2095 2095 HOH HOH A . D 4 HOH 96 2096 2096 HOH HOH A . D 4 HOH 97 2097 2097 HOH HOH A . D 4 HOH 98 2098 2098 HOH HOH A . D 4 HOH 99 2099 2099 HOH HOH A . D 4 HOH 100 2100 2100 HOH HOH A . D 4 HOH 101 2101 2101 HOH HOH A . D 4 HOH 102 2102 2102 HOH HOH A . D 4 HOH 103 2103 2103 HOH HOH A . D 4 HOH 104 2104 2104 HOH HOH A . D 4 HOH 105 2105 2105 HOH HOH A . D 4 HOH 106 2106 2106 HOH HOH A . D 4 HOH 107 2107 2107 HOH HOH A . D 4 HOH 108 2108 2108 HOH HOH A . D 4 HOH 109 2109 2109 HOH HOH A . D 4 HOH 110 2110 2110 HOH HOH A . D 4 HOH 111 2111 2111 HOH HOH A . D 4 HOH 112 2112 2112 HOH HOH A . D 4 HOH 113 2113 2113 HOH HOH A . D 4 HOH 114 2114 2114 HOH HOH A . D 4 HOH 115 2115 2115 HOH HOH A . D 4 HOH 116 2116 2116 HOH HOH A . D 4 HOH 117 2117 2117 HOH HOH A . D 4 HOH 118 2118 2118 HOH HOH A . D 4 HOH 119 2119 2119 HOH HOH A . D 4 HOH 120 2120 2120 HOH HOH A . D 4 HOH 121 2121 2121 HOH HOH A . D 4 HOH 122 2122 2122 HOH HOH A . D 4 HOH 123 2123 2123 HOH HOH A . D 4 HOH 124 2124 2124 HOH HOH A . D 4 HOH 125 2125 2125 HOH HOH A . D 4 HOH 126 2126 2126 HOH HOH A . D 4 HOH 127 2127 2127 HOH HOH A . D 4 HOH 128 2128 2128 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dodecameric _pdbx_struct_assembly.oligomeric_count 12 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 7_665 -z+1,-x+1,y 0.0000000000 0.0000000000 -1.0000000000 88.4530000000 -1.0000000000 0.0000000000 0.0000000000 88.4530000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 4 'crystal symmetry operation' 6_665 z+1,-x+1,-y 0.0000000000 0.0000000000 1.0000000000 88.4530000000 -1.0000000000 0.0000000000 0.0000000000 88.4530000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 5 'crystal symmetry operation' 10_656 -y+1,z,-x+1 0.0000000000 -1.0000000000 0.0000000000 88.4530000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 88.4530000000 6 'crystal symmetry operation' 12_654 -y+1,-z,x-1 0.0000000000 -1.0000000000 0.0000000000 88.4530000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -88.4530000000 7 'crystal symmetry operation' 11_656 y+1,-z,-x+1 0.0000000000 1.0000000000 0.0000000000 88.4530000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 88.4530000000 8 'crystal symmetry operation' 9_654 y+1,z,x-1 0.0000000000 1.0000000000 0.0000000000 88.4530000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -88.4530000000 9 'crystal symmetry operation' 8_645 -z+1,x-1,-y 0.0000000000 0.0000000000 -1.0000000000 88.4530000000 1.0000000000 0.0000000000 0.0000000000 -88.4530000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 5_645 z+1,x-1,y 0.0000000000 0.0000000000 1.0000000000 88.4530000000 1.0000000000 0.0000000000 0.0000000000 -88.4530000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 3_755 -x+2,y,-z -1.0000000000 0.0000000000 0.0000000000 176.9060000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 12 'crystal symmetry operation' 2_755 -x+2,-y,z -1.0000000000 0.0000000000 0.0000000000 176.9060000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A FE 1210 ? B FE . 2 1 A HOH 2015 ? D HOH . 3 1 A HOH 2044 ? D HOH . 4 1 A HOH 2124 ? D HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 171 ? A GLU 171 ? 1_555 FE ? B FE . ? A FE 1210 ? 1_555 OE2 ? A GLU 171 ? A GLU 171 ? 10_656 119.1 ? 2 OE2 ? A GLU 171 ? A GLU 171 ? 1_555 FE ? B FE . ? A FE 1210 ? 1_555 OE2 ? A GLU 171 ? A GLU 171 ? 7_665 119.8 ? 3 OE2 ? A GLU 171 ? A GLU 171 ? 10_656 FE ? B FE . ? A FE 1210 ? 1_555 OE2 ? A GLU 171 ? A GLU 171 ? 7_665 118.1 ? 4 OD2 ? A ASP 193 ? A ASP 193 ? 12_654 MG ? C MG . ? A MG 1213 ? 1_555 OD1 ? A ASN 195 ? A ASN 195 ? 12_654 84.0 ? 5 OD2 ? A ASP 193 ? A ASP 193 ? 12_654 MG ? C MG . ? A MG 1213 ? 1_555 OD2 ? A ASP 132 ? A ASP 132 ? 1_555 81.8 ? 6 OD1 ? A ASN 195 ? A ASN 195 ? 12_654 MG ? C MG . ? A MG 1213 ? 1_555 OD2 ? A ASP 132 ? A ASP 132 ? 1_555 123.8 ? 7 OD2 ? A ASP 193 ? A ASP 193 ? 12_654 MG ? C MG . ? A MG 1213 ? 1_555 OD1 ? A ASP 133 ? A ASP 133 ? 1_555 148.7 ? 8 OD1 ? A ASN 195 ? A ASN 195 ? 12_654 MG ? C MG . ? A MG 1213 ? 1_555 OD1 ? A ASP 133 ? A ASP 133 ? 1_555 126.8 ? 9 OD2 ? A ASP 132 ? A ASP 132 ? 1_555 MG ? C MG . ? A MG 1213 ? 1_555 OD1 ? A ASP 133 ? A ASP 133 ? 1_555 75.7 ? 10 OD2 ? A ASP 193 ? A ASP 193 ? 12_654 MG ? C MG . ? A MG 1213 ? 1_555 O ? A ILE 200 ? A ILE 200 ? 1_555 74.1 ? 11 OD1 ? A ASN 195 ? A ASN 195 ? 12_654 MG ? C MG . ? A MG 1213 ? 1_555 O ? A ILE 200 ? A ILE 200 ? 1_555 141.9 ? 12 OD2 ? A ASP 132 ? A ASP 132 ? 1_555 MG ? C MG . ? A MG 1213 ? 1_555 O ? A ILE 200 ? A ILE 200 ? 1_555 84.0 ? 13 OD1 ? A ASP 133 ? A ASP 133 ? 1_555 MG ? C MG . ? A MG 1213 ? 1_555 O ? A ILE 200 ? A ILE 200 ? 1_555 82.0 ? 14 OD2 ? A ASP 193 ? A ASP 193 ? 12_654 MG ? C MG . ? A MG 1213 ? 1_555 O ? D HOH . ? A HOH 2084 ? 1_555 117.4 ? 15 OD1 ? A ASN 195 ? A ASN 195 ? 12_654 MG ? C MG . ? A MG 1213 ? 1_555 O ? D HOH . ? A HOH 2084 ? 1_555 78.5 ? 16 OD2 ? A ASP 132 ? A ASP 132 ? 1_555 MG ? C MG . ? A MG 1213 ? 1_555 O ? D HOH . ? A HOH 2084 ? 1_555 153.6 ? 17 OD1 ? A ASP 133 ? A ASP 133 ? 1_555 MG ? C MG . ? A MG 1213 ? 1_555 O ? D HOH . ? A HOH 2084 ? 1_555 79.2 ? 18 O ? A ILE 200 ? A ILE 200 ? 1_555 MG ? C MG . ? A MG 1213 ? 1_555 O ? D HOH . ? A HOH 2084 ? 1_555 84.3 ? 19 OD2 ? A ASP 193 ? A ASP 193 ? 12_654 MG ? C MG . ? A MG 1213 ? 1_555 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 97.2 ? 20 OD1 ? A ASN 195 ? A ASN 195 ? 12_654 MG ? C MG . ? A MG 1213 ? 1_555 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 74.2 ? 21 OD2 ? A ASP 132 ? A ASP 132 ? 1_555 MG ? C MG . ? A MG 1213 ? 1_555 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 54.4 ? 22 OD1 ? A ASP 133 ? A ASP 133 ? 1_555 MG ? C MG . ? A MG 1213 ? 1_555 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 87.3 ? 23 O ? A ILE 200 ? A ILE 200 ? 1_555 MG ? C MG . ? A MG 1213 ? 1_555 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 138.4 ? 24 O ? D HOH . ? A HOH 2084 ? 1_555 MG ? C MG . ? A MG 1213 ? 1_555 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 132.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-02-20 2 'Structure model' 1 1 2011-05-07 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 # _pdbx_database_remark.id 650 _pdbx_database_remark.text ; HELIX DETERMINATION METHOD: AUTHOR PROVIDED. ; # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLN _pdbx_validate_close_contact.auth_seq_id_1 135 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 2087 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.11 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 120 ? ? -95.69 48.00 2 1 SER A 121 ? ? -52.58 -99.38 3 1 ASP A 193 ? ? -166.03 118.94 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PRO 207 ? CA ? A PRO 207 CA 2 1 Y 1 A PRO 207 ? C ? A PRO 207 C 3 1 Y 1 A PRO 207 ? O ? A PRO 207 O 4 1 Y 1 A PRO 207 ? CB ? A PRO 207 CB 5 1 Y 1 A PRO 207 ? CG ? A PRO 207 CG 6 1 Y 1 A PRO 207 ? CD ? A PRO 207 CD # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 1 ? A ASN 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A VAL 3 ? A VAL 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A THR 6 ? A THR 6 7 1 Y 1 A ASN 7 ? A ASN 7 8 1 Y 1 A VAL 8 ? A VAL 8 9 1 Y 1 A ASN 9 ? A ASN 9 10 1 Y 1 A THR 10 ? A THR 10 11 1 Y 1 A PRO 11 ? A PRO 11 12 1 Y 1 A ALA 12 ? A ALA 12 13 1 Y 1 A PRO 13 ? A PRO 13 14 1 Y 1 A ASN 14 ? A ASN 14 15 1 Y 1 A THR 15 ? A THR 15 16 1 Y 1 A GLY 16 ? A GLY 16 17 1 Y 1 A GLN 17 ? A GLN 17 18 1 Y 1 A SER 18 ? A SER 18 19 1 Y 1 A THR 19 ? A THR 19 20 1 Y 1 A ALA 20 ? A ALA 20 21 1 Y 1 A GLN 21 ? A GLN 21 22 1 Y 1 A ASN 22 ? A ASN 22 23 1 Y 1 A THR 23 ? A THR 23 24 1 Y 1 A ASN 24 ? A ASN 24 25 1 Y 1 A THR 25 ? A THR 25 26 1 Y 1 A ALA 26 ? A ALA 26 27 1 Y 1 A SER 27 ? A SER 27 28 1 Y 1 A PRO 28 ? A PRO 28 29 1 Y 1 A LEU 29 ? A LEU 29 30 1 Y 1 A PRO 30 ? A PRO 30 31 1 Y 1 A TYR 31 ? A TYR 31 32 1 Y 1 A ASN 32 ? A ASN 32 33 1 Y 1 A ARG 33 ? A ARG 33 34 1 Y 1 A ALA 34 ? A ALA 34 35 1 Y 1 A THR 35 ? A THR 35 36 1 Y 1 A THR 36 ? A THR 36 37 1 Y 1 A LEU 37 ? A LEU 37 38 1 Y 1 A PRO 38 ? A PRO 38 39 1 Y 1 A ALA 39 ? A ALA 39 40 1 Y 1 A ALA 40 ? A ALA 40 41 1 Y 1 A GLY 41 ? A GLY 41 42 1 Y 1 A LEU 208 ? A LEU 208 43 1 Y 1 A ARG 209 ? A ARG 209 44 1 Y 1 A GLY 210 ? A GLY 210 45 1 Y 1 A ARG 211 ? A ARG 211 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (III) ION' FE 3 'MAGNESIUM ION' MG 4 water HOH #