data_2CAB # _entry.id 2CAB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CAB pdb_00002cab 10.2210/pdb2cab/pdb WWPDB D_1000177886 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1984-02-02 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 1 4 2024-02-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_conf 3 4 'Structure model' struct_conf_type 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_struct_conn_angle 8 5 'Structure model' struct_conn 9 5 'Structure model' struct_ref_seq_dif 10 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.value' 11 5 'Structure model' '_struct_conn.pdbx_dist_value' 12 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 13 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 14 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 15 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 16 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 17 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 18 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 19 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 20 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 21 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 22 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 23 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 24 5 'Structure model' '_struct_ref_seq_dif.details' 25 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 26 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 27 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 1984-02-02 _pdbx_database_PDB_obs_spr.pdb_id 2CAB _pdbx_database_PDB_obs_spr.replace_pdb_id 1CAB _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CAB _pdbx_database_status.recvd_initial_deposition_date 1983-10-05 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kannan, K.K.' 1 'Ramanadham, M.' 2 'Jones, T.A.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure, refinement, and function of carbonic anhydrase isozymes: refinement of human carbonic anhydrase I' Ann.N.Y.Acad.Sci. 429 49 60 1984 ANYAA9 US 0077-8923 0332 ? 6430186 ? 1 'Structure and Function of Carbonic Anhydrases' 'Biomolecular Structure, Conformation, Function and Evolution' 1 165 ? 1980 ? ? 0-08-023187-X 0983 'Pergamon Press, New York' ? ? 2 'Crystal Structure of Carbonic Anhydrase' 'Biophysics and Physiology of Carbon Dioxide' ? 184 ? 1980 ? ? 3-540-09892-5 0981 'Springer Verlag, Berlin' ? ? 3 'Structure, Refinement, and Function of Human Carbonic Anhydrase-B' 'Int.J.Quantum Chem.Quantum Chem.Symp.' 20 199 ? 1981 IJQSDI US 0161-3642 0936 ? ? ? 4 ;Structure and Function of Carbonic Anhydrases. Imidazole Binding to Human Carbonic Anhydrace B and the Mechanism of Action of Carbonic Anhydrases ; 'FEBS Lett.' 73 115 ? 1977 FEBLAL NE 0014-5793 0165 ? ? ? 5 'Crystal Structure of Human Erythrocyte Carbonic Anhydrase B, Three-Dimensional Structure at a Nominal 2.2 Angstroms Resolution' Proc.Natl.Acad.Sci.USA 72 51 ? 1975 PNASA6 US 0027-8424 0040 ? ? ? 6 'Structural Relationship of Human Erythrocyte Carbonic Anhydrase Isozymes B and C' 'Isozymes-Molecular Structure' 1 575 ? 1975 ? ? 0-12-472701-8 0979 'Academic Press,New York' ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kannan, K.K.' 1 ? primary 'Ramanadham, M.' 2 ? primary 'Jones, T.A.' 3 ? 1 'Kannan, K.K.' 4 ? 2 'Kannan, K.K.' 5 ? 3 'Kannan, K.K.' 6 ? 3 'Ramanadham, M.' 7 ? 4 'Kannan, K.K.' 8 ? 4 'Petef, M.' 9 ? 4 'Fridborg, K.' 10 ? 4 'Cid-Dresdner, H.' 11 ? 4 'Lovgren, S.' 12 ? 5 'Kannan, K.K.' 13 ? 5 'Notstrand, B.' 14 ? 5 'Fridborg, K.' 15 ? 5 'Lovgren, S.' 16 ? 5 'Ohlsson, A.' 17 ? 5 'Petef, M.' 18 ? 6 'Notstrand, B.' 19 ? 6 'Vaara, I.' 20 ? 6 'Kannan, K.K.' 21 ? # loop_ _citation_editor.citation_id _citation_editor.name _citation_editor.ordinal 1 'Srinivasan, R.' 1 2 'Bauer, C.' 2 2 'Gros, G.' 3 2 'Bartels, H.' 4 6 'Markert, C.L.' 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CARBONIC ANHYDRASE FORM B' 28789.016 1 4.2.1.1 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNQDRSVLK GGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKV LDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVP MQHNNRPTQPLKGRTVRASF ; _entity_poly.pdbx_seq_one_letter_code_can ;ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNQDRSVLK GGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKV LDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVP MQHNNRPTQPLKGRTVRASF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 SER n 1 3 PRO n 1 4 ASP n 1 5 TRP n 1 6 GLY n 1 7 TYR n 1 8 ASP n 1 9 ASP n 1 10 LYS n 1 11 ASN n 1 12 GLY n 1 13 PRO n 1 14 GLU n 1 15 GLN n 1 16 TRP n 1 17 SER n 1 18 LYS n 1 19 LEU n 1 20 TYR n 1 21 PRO n 1 22 ILE n 1 23 ALA n 1 24 ASN n 1 25 GLY n 1 26 ASN n 1 27 ASN n 1 28 GLN n 1 29 SER n 1 30 PRO n 1 31 VAL n 1 32 ASP n 1 33 ILE n 1 34 LYS n 1 35 THR n 1 36 SER n 1 37 GLU n 1 38 THR n 1 39 LYS n 1 40 HIS n 1 41 ASP n 1 42 THR n 1 43 SER n 1 44 LEU n 1 45 LYS n 1 46 PRO n 1 47 ILE n 1 48 SER n 1 49 VAL n 1 50 SER n 1 51 TYR n 1 52 ASN n 1 53 PRO n 1 54 ALA n 1 55 THR n 1 56 ALA n 1 57 LYS n 1 58 GLU n 1 59 ILE n 1 60 ILE n 1 61 ASN n 1 62 VAL n 1 63 GLY n 1 64 HIS n 1 65 SER n 1 66 PHE n 1 67 HIS n 1 68 VAL n 1 69 ASN n 1 70 PHE n 1 71 GLU n 1 72 ASP n 1 73 ASN n 1 74 GLN n 1 75 ASP n 1 76 ARG n 1 77 SER n 1 78 VAL n 1 79 LEU n 1 80 LYS n 1 81 GLY n 1 82 GLY n 1 83 PRO n 1 84 PHE n 1 85 SER n 1 86 ASP n 1 87 SER n 1 88 TYR n 1 89 ARG n 1 90 LEU n 1 91 PHE n 1 92 GLN n 1 93 PHE n 1 94 HIS n 1 95 PHE n 1 96 HIS n 1 97 TRP n 1 98 GLY n 1 99 SER n 1 100 THR n 1 101 ASN n 1 102 GLU n 1 103 HIS n 1 104 GLY n 1 105 SER n 1 106 GLU n 1 107 HIS n 1 108 THR n 1 109 VAL n 1 110 ASP n 1 111 GLY n 1 112 VAL n 1 113 LYS n 1 114 TYR n 1 115 SER n 1 116 ALA n 1 117 GLU n 1 118 LEU n 1 119 HIS n 1 120 VAL n 1 121 ALA n 1 122 HIS n 1 123 TRP n 1 124 ASN n 1 125 SER n 1 126 ALA n 1 127 LYS n 1 128 TYR n 1 129 SER n 1 130 SER n 1 131 LEU n 1 132 ALA n 1 133 GLU n 1 134 ALA n 1 135 ALA n 1 136 SER n 1 137 LYS n 1 138 ALA n 1 139 ASP n 1 140 GLY n 1 141 LEU n 1 142 ALA n 1 143 VAL n 1 144 ILE n 1 145 GLY n 1 146 VAL n 1 147 LEU n 1 148 MET n 1 149 LYS n 1 150 VAL n 1 151 GLY n 1 152 GLU n 1 153 ALA n 1 154 ASN n 1 155 PRO n 1 156 LYS n 1 157 LEU n 1 158 GLN n 1 159 LYS n 1 160 VAL n 1 161 LEU n 1 162 ASP n 1 163 ALA n 1 164 LEU n 1 165 GLN n 1 166 ALA n 1 167 ILE n 1 168 LYS n 1 169 THR n 1 170 LYS n 1 171 GLY n 1 172 LYS n 1 173 ARG n 1 174 ALA n 1 175 PRO n 1 176 PHE n 1 177 THR n 1 178 ASN n 1 179 PHE n 1 180 ASP n 1 181 PRO n 1 182 SER n 1 183 THR n 1 184 LEU n 1 185 LEU n 1 186 PRO n 1 187 SER n 1 188 SER n 1 189 LEU n 1 190 ASP n 1 191 PHE n 1 192 TRP n 1 193 THR n 1 194 TYR n 1 195 PRO n 1 196 GLY n 1 197 SER n 1 198 LEU n 1 199 THR n 1 200 HIS n 1 201 PRO n 1 202 PRO n 1 203 LEU n 1 204 TYR n 1 205 GLU n 1 206 SER n 1 207 VAL n 1 208 THR n 1 209 TRP n 1 210 ILE n 1 211 ILE n 1 212 CYS n 1 213 LYS n 1 214 GLU n 1 215 SER n 1 216 ILE n 1 217 SER n 1 218 VAL n 1 219 SER n 1 220 SER n 1 221 GLU n 1 222 GLN n 1 223 LEU n 1 224 ALA n 1 225 GLN n 1 226 PHE n 1 227 ARG n 1 228 SER n 1 229 LEU n 1 230 LEU n 1 231 SER n 1 232 ASN n 1 233 VAL n 1 234 GLU n 1 235 GLY n 1 236 ASP n 1 237 ASN n 1 238 ALA n 1 239 VAL n 1 240 PRO n 1 241 MET n 1 242 GLN n 1 243 HIS n 1 244 ASN n 1 245 ASN n 1 246 ARG n 1 247 PRO n 1 248 THR n 1 249 GLN n 1 250 PRO n 1 251 LEU n 1 252 LYS n 1 253 GLY n 1 254 ARG n 1 255 THR n 1 256 VAL n 1 257 ARG n 1 258 ALA n 1 259 SER n 1 260 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 TRP 5 5 5 TRP TRP A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 TRP 97 97 97 TRP TRP A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 HIS 103 103 103 HIS HIS A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 TRP 123 123 123 TRP TRP A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 MET 148 148 148 MET MET A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 PRO 155 155 155 PRO PRO A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 GLN 158 158 158 GLN GLN A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 ASN 178 178 178 ASN ASN A . n A 1 179 PHE 179 179 179 PHE PHE A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 PRO 181 181 181 PRO PRO A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 THR 183 183 183 THR THR A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 PRO 186 186 186 PRO PRO A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 TRP 192 192 192 TRP TRP A . n A 1 193 THR 193 193 193 THR THR A . n A 1 194 TYR 194 194 194 TYR TYR A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 HIS 200 200 200 HIS HIS A . n A 1 201 PRO 201 201 201 PRO PRO A . n A 1 202 PRO 202 202 202 PRO PRO A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 TYR 204 204 204 TYR TYR A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 SER 206 206 206 SER SER A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 THR 208 208 208 THR THR A . n A 1 209 TRP 209 209 209 TRP TRP A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 ILE 211 211 211 ILE ILE A . n A 1 212 CYS 212 212 212 CYS CYS A . n A 1 213 LYS 213 213 213 LYS LYS A . n A 1 214 GLU 214 214 214 GLU GLU A . n A 1 215 SER 215 215 215 SER SER A . n A 1 216 ILE 216 216 216 ILE ILE A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 SER 219 219 219 SER SER A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 GLN 222 222 222 GLN GLN A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 GLN 225 225 225 GLN GLN A . n A 1 226 PHE 226 226 226 PHE PHE A . n A 1 227 ARG 227 227 227 ARG ARG A . n A 1 228 SER 228 228 228 SER SER A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 SER 231 231 231 SER SER A . n A 1 232 ASN 232 232 232 ASN ASN A . n A 1 233 VAL 233 233 233 VAL VAL A . n A 1 234 GLU 234 234 234 GLU GLU A . n A 1 235 GLY 235 235 235 GLY GLY A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 ASN 237 237 237 ASN ASN A . n A 1 238 ALA 238 238 238 ALA ALA A . n A 1 239 VAL 239 239 239 VAL VAL A . n A 1 240 PRO 240 240 240 PRO PRO A . n A 1 241 MET 241 241 241 MET MET A . n A 1 242 GLN 242 242 242 GLN GLN A . n A 1 243 HIS 243 243 243 HIS HIS A . n A 1 244 ASN 244 244 244 ASN ASN A . n A 1 245 ASN 245 245 245 ASN ASN A . n A 1 246 ARG 246 246 246 ARG ARG A . n A 1 247 PRO 247 247 247 PRO PRO A . n A 1 248 THR 248 248 248 THR THR A . n A 1 249 GLN 249 249 249 GLN GLN A . n A 1 250 PRO 250 250 250 PRO PRO A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 LYS 252 252 252 LYS LYS A . n A 1 253 GLY 253 253 253 GLY GLY A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 THR 255 255 255 THR THR A . n A 1 256 VAL 256 256 256 VAL VAL A . n A 1 257 ARG 257 257 257 ARG ARG A . n A 1 258 ALA 258 258 258 ALA ALA A . n A 1 259 SER 259 259 259 SER SER A . n A 1 260 PHE 260 260 260 PHE PHE A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 261 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _software.name CORELS _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # _cell.entry_id 2CAB _cell.length_a 81.500 _cell.length_b 73.600 _cell.length_c 37.100 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2CAB _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # _exptl.entry_id 2CAB _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.93 _exptl_crystal.density_percent_sol 36.26 _exptl_crystal.description ? # _refine.entry_id 2CAB _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 2.0 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1930000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details 'HELICES E1 AND E2 WERE ASSIGNED DEFAULT TYPE 1 (ALPHA).' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2009 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2010 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low . # _database_PDB_matrix.entry_id 2CAB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2CAB _struct.title 'STRUCTURE, REFINEMENT AND FUNCTION OF CARBONIC ANHYDRASE ISOZYMES. REFINEMENT OF HUMAN CARBONIC ANHYDRASE I' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CAB _struct_keywords.pdbx_keywords HYDRO-LYASE _struct_keywords.text HYDRO-LYASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CAH1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00915 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLK GGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKV LDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVP MQHNNRPTQPLKGRTVRASF ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CAB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 260 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00915 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 260 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 260 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CAB GLN A 74 ? UNP P00915 ASP 74 conflict 74 1 1 2CAB ASP A 75 ? UNP P00915 ASN 75 conflict 75 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 A TRP A 16 ? TYR A 20 ? TRP A 16 TYR A 20 1 'CONTIGUOUS WITH HELIX B' 5 HELX_P HELX_P2 B TYR A 20 ? GLY A 25 ? TYR A 20 GLY A 25 5 'CONTIGUOUS WITH HELIX A' 6 HELX_P HELX_P3 D SER A 130 ? LYS A 137 ? SER A 130 LYS A 137 1 'ALSO DESIGNATED AS 3/10 HELIX' 8 HELX_P HELX_P4 E1 PRO A 155 ? ASP A 162 ? PRO A 155 ASP A 162 1 'CONTIGUOUS WITH HELIX E2' 8 HELX_P HELX_P5 E2 ASP A 162 ? LYS A 168 ? ASP A 162 LYS A 168 1 'CONTIGUOUS WITH HELIX E1' 7 HELX_P HELX_P6 F PRO A 181 ? LEU A 185 ? PRO A 181 LEU A 185 5 ? 5 HELX_P HELX_P7 G SER A 219 ? LEU A 229 ? SER A 219 LEU A 229 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 94 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 94 A ZN 261 1_555 ? ? ? ? ? ? ? 1.927 ? ? metalc2 metalc ? ? A HIS 96 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 96 A ZN 261 1_555 ? ? ? ? ? ? ? 1.943 ? ? metalc3 metalc ? ? A HIS 119 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 119 A ZN 261 1_555 ? ? ? ? ? ? ? 1.903 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 94 ? A HIS 94 ? 1_555 ZN ? B ZN . ? A ZN 261 ? 1_555 NE2 ? A HIS 96 ? A HIS 96 ? 1_555 107.9 ? 2 NE2 ? A HIS 94 ? A HIS 94 ? 1_555 ZN ? B ZN . ? A ZN 261 ? 1_555 ND1 ? A HIS 119 ? A HIS 119 ? 1_555 115.4 ? 3 NE2 ? A HIS 96 ? A HIS 96 ? 1_555 ZN ? B ZN . ? A ZN 261 ? 1_555 ND1 ? A HIS 119 ? A HIS 119 ? 1_555 97.9 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 29 A . ? SER 29 A PRO 30 A ? PRO 30 A 1 -1.75 2 PRO 201 A . ? PRO 201 A PRO 202 A ? PRO 202 A 1 2.14 # _struct_sheet.id S _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S 1 2 ? parallel S 2 3 ? anti-parallel S 3 4 ? anti-parallel S 4 5 ? anti-parallel S 5 6 ? anti-parallel S 6 7 ? anti-parallel S 7 8 ? anti-parallel S 8 9 ? anti-parallel S 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S 1 LYS A 39 ? ASP A 41 ? LYS A 39 ASP A 41 S 2 VAL A 256 ? SER A 259 ? VAL A 256 SER A 259 S 3 PHE A 191 ? GLY A 196 ? PHE A 191 GLY A 196 S 4 SER A 206 ? CYS A 212 ? SER A 206 CYS A 212 S 5 GLY A 140 ? GLY A 151 ? GLY A 140 GLY A 151 S 6 ALA A 116 ? ASN A 124 ? ALA A 116 ASN A 124 S 7 SER A 87 ? HIS A 96 ? SER A 87 HIS A 96 S 8 SER A 65 ? GLU A 71 ? SER A 65 GLU A 71 S 9 THR A 55 ? VAL A 62 ? THR A 55 VAL A 62 S 10 GLY A 171 ? PHE A 176 ? GLY A 171 PHE A 176 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S 1 2 O ALA A 258 ? O ALA A 258 N ASP A 41 ? N ASP A 41 S 2 3 O ARG A 257 ? O ARG A 257 N THR A 193 ? N THR A 193 S 3 4 O TYR A 194 ? O TYR A 194 N TRP A 209 ? N TRP A 209 S 4 5 O THR A 208 ? O THR A 208 N VAL A 143 ? N VAL A 143 S 5 6 O ILE A 144 ? O ILE A 144 N VAL A 120 ? N VAL A 120 S 6 7 O HIS A 119 ? O HIS A 119 N HIS A 94 ? N HIS A 94 S 7 8 O HIS A 94 ? O HIS A 94 N HIS A 67 ? N HIS A 67 S 8 9 O HIS A 67 ? O HIS A 67 N ILE A 60 ? N ILE A 60 S 9 10 O ILE A 59 ? O ILE A 59 N ALA A 174 ? N ALA A 174 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 261 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 261' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 HIS A 94 ? HIS A 94 . ? 1_555 ? 2 AC1 3 HIS A 96 ? HIS A 96 . ? 1_555 ? 3 AC1 3 HIS A 119 ? HIS A 119 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLN 74 ? ? NE A ARG 76 ? ? 0.80 2 1 OE1 A GLN 74 ? ? CZ A ARG 76 ? ? 0.99 3 1 OE1 A GLN 74 ? ? CD A ARG 76 ? ? 1.48 4 1 OE1 A GLN 74 ? ? NH1 A ARG 76 ? ? 1.57 5 1 O A ASP 9 ? ? OE1 A GLN 15 ? ? 1.95 6 1 O A LYS 10 ? ? NE2 A GLN 15 ? ? 2.01 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 CA A THR 42 ? ? 1_555 NZ A LYS 252 ? ? 2_555 0.52 2 1 ND2 A ASN 26 ? ? 1_555 O A ALA 258 ? ? 2_554 0.58 3 1 CD A LYS 39 ? ? 1_555 CG A GLU 205 ? ? 2_555 0.59 4 1 CA A ASN 26 ? ? 1_555 C A HIS 40 ? ? 2_554 0.63 5 1 CA A GLU 14 ? ? 1_555 CE A LYS 159 ? ? 3_655 0.85 6 1 CG A LYS 39 ? ? 1_555 CD A GLU 205 ? ? 2_555 0.86 7 1 N A ASN 26 ? ? 1_555 N A ASP 41 ? ? 2_554 0.87 8 1 NZ A LYS 137 ? ? 1_555 N A GLY 253 ? ? 2_554 0.89 9 1 CG A LYS 39 ? ? 1_555 OE2 A GLU 205 ? ? 2_555 0.92 10 1 OD1 A ASP 9 ? ? 1_555 CG A PRO 53 ? ? 3_655 0.96 11 1 CD A LYS 39 ? ? 1_555 CD A GLU 205 ? ? 2_555 0.98 12 1 OD1 A ASN 27 ? ? 1_555 CA A LYS 39 ? ? 2_554 0.99 13 1 CE A LYS 137 ? ? 1_555 N A GLY 253 ? ? 2_554 1.12 14 1 NZ A LYS 137 ? ? 1_555 C A LYS 252 ? ? 2_554 1.12 15 1 C A GLY 25 ? ? 1_555 CA A ASP 41 ? ? 2_554 1.13 16 1 CB A ALA 126 ? ? 1_555 OE1 A GLU 234 ? ? 4_445 1.13 17 1 CB A ASN 24 ? ? 1_555 CB A SER 43 ? ? 2_554 1.20 18 1 C A ASN 26 ? ? 1_555 O A HIS 40 ? ? 2_554 1.20 19 1 N A ASN 26 ? ? 1_555 C A HIS 40 ? ? 2_554 1.22 20 1 CB A ASN 26 ? ? 1_555 CA A HIS 40 ? ? 2_554 1.23 21 1 CA A ASN 26 ? ? 1_555 O A HIS 40 ? ? 2_554 1.27 22 1 CD2 A HIS 40 ? ? 1_555 CB A LYS 252 ? ? 2_555 1.28 23 1 N A GLU 14 ? ? 1_555 NZ A LYS 159 ? ? 3_655 1.31 24 1 CB A SER 136 ? ? 1_555 O A GLY 253 ? ? 2_554 1.32 25 1 N A ASN 26 ? ? 1_555 CA A ASP 41 ? ? 2_554 1.34 26 1 CB A LYS 39 ? ? 1_555 OE2 A GLU 205 ? ? 2_555 1.34 27 1 C A ASN 24 ? ? 1_555 OD1 A ASP 41 ? ? 2_554 1.35 28 1 OG A SER 136 ? ? 1_555 O A GLY 253 ? ? 2_554 1.36 29 1 OD1 A ASN 27 ? ? 1_555 C A LYS 39 ? ? 2_554 1.42 30 1 OE2 A GLU 14 ? ? 1_555 CD A LYS 159 ? ? 3_655 1.43 31 1 O A ASN 24 ? ? 1_555 OD1 A ASP 41 ? ? 2_554 1.45 32 1 N A ASN 27 ? ? 1_555 O A HIS 40 ? ? 2_554 1.45 33 1 NE2 A HIS 40 ? ? 1_555 CB A LYS 252 ? ? 2_555 1.45 34 1 C A ASN 26 ? ? 1_555 C A HIS 40 ? ? 2_554 1.49 35 1 CB A THR 42 ? ? 1_555 NZ A LYS 252 ? ? 2_555 1.50 36 1 CA A ASN 26 ? ? 1_555 N A ASP 41 ? ? 2_554 1.52 37 1 O A ASN 24 ? ? 1_555 N A SER 43 ? ? 2_554 1.56 38 1 CB A GLU 14 ? ? 1_555 CE A LYS 159 ? ? 3_655 1.57 39 1 CB A THR 42 ? ? 1_555 CE A LYS 252 ? ? 2_555 1.58 40 1 N A ASN 26 ? ? 1_555 O A HIS 40 ? ? 2_554 1.58 41 1 NZ A LYS 18 ? ? 1_555 CG A LYS 156 ? ? 3_655 1.60 42 1 CB A ASN 26 ? ? 1_555 C A HIS 40 ? ? 2_554 1.60 43 1 CD A GLU 14 ? ? 1_555 CD A LYS 159 ? ? 3_655 1.61 44 1 N A GLY 25 ? ? 1_555 OD1 A ASP 41 ? ? 2_554 1.62 45 1 CG2 A THR 42 ? ? 1_555 CE A LYS 252 ? ? 2_555 1.64 46 1 OD1 A ASN 26 ? ? 1_555 ND1 A HIS 40 ? ? 2_554 1.67 47 1 CG1 A ILE 22 ? ? 1_555 NZ A LYS 39 ? ? 2_554 1.67 48 1 N A THR 42 ? ? 1_555 NZ A LYS 252 ? ? 2_555 1.68 49 1 CA A GLU 14 ? ? 1_555 NZ A LYS 159 ? ? 3_655 1.68 50 1 CA A GLY 25 ? ? 1_555 CA A ASP 41 ? ? 2_554 1.69 51 1 N A GLU 14 ? ? 1_555 CE A LYS 159 ? ? 3_655 1.70 52 1 CG2 A THR 42 ? ? 1_555 CD A LYS 252 ? ? 2_555 1.70 53 1 CG A GLU 14 ? ? 1_555 NZ A LYS 159 ? ? 3_655 1.71 54 1 CA A GLY 25 ? ? 1_555 CG A ASP 41 ? ? 2_554 1.71 55 1 CB A GLU 14 ? ? 1_555 CD A LYS 159 ? ? 3_655 1.73 56 1 CA A ASN 26 ? ? 1_555 CA A HIS 40 ? ? 2_554 1.73 57 1 O A ASN 26 ? ? 1_555 CB A HIS 40 ? ? 2_554 1.74 58 1 CB A GLU 14 ? ? 1_555 NZ A LYS 159 ? ? 3_655 1.76 59 1 ND2 A ASN 26 ? ? 1_555 C A ALA 258 ? ? 2_554 1.76 60 1 OG A SER 136 ? ? 1_555 C A GLY 253 ? ? 2_554 1.76 61 1 CB A ALA 126 ? ? 1_555 CD A GLU 234 ? ? 4_445 1.78 62 1 CA A GLY 25 ? ? 1_555 CB A ASP 41 ? ? 2_554 1.79 63 1 CG A ASN 26 ? ? 1_555 ND1 A HIS 40 ? ? 2_554 1.79 64 1 CG A LYS 39 ? ? 1_555 CG A GLU 205 ? ? 2_555 1.79 65 1 O A GLY 25 ? ? 1_555 N A THR 42 ? ? 2_554 1.81 66 1 CG A LYS 39 ? ? 1_555 OE1 A GLU 205 ? ? 2_555 1.81 67 1 CG A ASN 26 ? ? 1_555 O A ALA 258 ? ? 2_554 1.82 68 1 C A ASN 26 ? ? 1_555 CA A HIS 40 ? ? 2_554 1.82 69 1 CG A ASN 27 ? ? 1_555 N A HIS 40 ? ? 2_554 1.83 70 1 CD A LYS 39 ? ? 1_555 OE1 A GLU 205 ? ? 2_555 1.86 71 1 OD1 A ASN 27 ? ? 1_555 N A HIS 40 ? ? 2_554 1.86 72 1 CB A ASN 26 ? ? 1_555 CB A HIS 40 ? ? 2_554 1.86 73 1 CB A ASN 26 ? ? 1_555 N A ASP 41 ? ? 2_554 1.87 74 1 CD1 A ILE 22 ? ? 1_555 CD A ARG 257 ? ? 2_554 1.87 75 1 CG A GLU 14 ? ? 1_555 CD A LYS 159 ? ? 3_655 1.88 76 1 CE A LYS 39 ? ? 1_555 CD A GLU 205 ? ? 2_555 1.88 77 1 OD1 A ASN 27 ? ? 1_555 N A LYS 39 ? ? 2_554 1.91 78 1 NE2 A HIS 40 ? ? 1_555 CG A LYS 252 ? ? 2_555 1.92 79 1 N A GLY 25 ? ? 1_555 CG A ASP 41 ? ? 2_554 1.93 80 1 CE A LYS 39 ? ? 1_555 CG A GLU 205 ? ? 2_555 1.93 81 1 CG A ASP 9 ? ? 1_555 CG A PRO 53 ? ? 3_655 1.94 82 1 OG A SER 136 ? ? 1_555 CA A GLY 253 ? ? 2_554 1.94 83 1 CD A LYS 39 ? ? 1_555 OE2 A GLU 205 ? ? 2_555 1.94 84 1 CD A LYS 39 ? ? 1_555 CB A GLU 205 ? ? 2_555 1.94 85 1 C A THR 42 ? ? 1_555 NZ A LYS 252 ? ? 2_555 1.94 86 1 OD1 A ASN 26 ? ? 1_555 O A ASP 41 ? ? 2_554 1.94 87 1 CA A THR 42 ? ? 1_555 CE A LYS 252 ? ? 2_555 1.98 88 1 NE2 A HIS 40 ? ? 1_555 CD A LYS 252 ? ? 2_555 1.98 89 1 C A GLY 25 ? ? 1_555 N A ASP 41 ? ? 2_554 1.99 90 1 CE A LYS 137 ? ? 1_555 C A LYS 252 ? ? 2_554 1.99 91 1 NZ A LYS 137 ? ? 1_555 CA A LYS 252 ? ? 2_554 2.00 92 1 CB A GLU 37 ? ? 1_555 CB A ALA 138 ? ? 2_555 2.03 93 1 OD1 A ASP 9 ? ? 1_555 CD A PRO 53 ? ? 3_655 2.03 94 1 OD1 A ASN 26 ? ? 1_555 CE1 A HIS 40 ? ? 2_554 2.03 95 1 O A ASN 24 ? ? 1_555 N A THR 42 ? ? 2_554 2.05 96 1 OE1 A GLU 133 ? ? 1_555 O A SER 259 ? ? 1_554 2.05 97 1 CG A ASN 27 ? ? 1_555 CA A LYS 39 ? ? 2_554 2.05 98 1 NZ A LYS 137 ? ? 1_555 CA A GLY 253 ? ? 2_554 2.05 99 1 C A GLY 25 ? ? 1_555 C A ASP 41 ? ? 2_554 2.06 100 1 OE2 A GLU 14 ? ? 1_555 CG A LYS 159 ? ? 3_655 2.09 101 1 O A GLY 25 ? ? 1_555 CA A ASP 41 ? ? 2_554 2.10 102 1 CB A ASN 26 ? ? 1_555 CG A HIS 40 ? ? 2_554 2.10 103 1 CE A LYS 137 ? ? 1_555 CA A GLY 253 ? ? 2_554 2.10 104 1 CB A ASN 24 ? ? 1_555 OG A SER 43 ? ? 2_554 2.11 105 1 CA A GLU 14 ? ? 1_555 CD A LYS 159 ? ? 3_655 2.12 106 1 CG A GLU 14 ? ? 1_555 CE A LYS 159 ? ? 3_655 2.12 107 1 N A ASN 27 ? ? 1_555 C A HIS 40 ? ? 2_554 2.12 108 1 NZ A LYS 137 ? ? 1_555 O A LYS 252 ? ? 2_554 2.12 109 1 CB A ASN 26 ? ? 1_555 ND1 A HIS 40 ? ? 2_554 2.13 110 1 CD A LYS 137 ? ? 1_555 N A GLY 253 ? ? 2_554 2.13 111 1 NZ A LYS 18 ? ? 1_555 NZ A LYS 156 ? ? 3_655 2.14 112 1 CA A GLY 25 ? ? 1_555 OD1 A ASP 41 ? ? 2_554 2.16 113 1 C A GLY 25 ? ? 1_555 O A HIS 40 ? ? 2_554 2.17 114 1 CG A ASN 26 ? ? 1_555 N A ASP 41 ? ? 2_554 2.17 115 1 OD1 A ASP 9 ? ? 1_555 CB A PRO 53 ? ? 3_655 2.17 116 1 O A GLY 25 ? ? 1_555 C A ASP 41 ? ? 2_554 2.19 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLN 74 ? ? OE1 A GLN 74 ? ? 5.675 1.235 4.440 0.022 N 2 1 CB A SER 77 ? ? OG A SER 77 ? ? 1.293 1.418 -0.125 0.013 N 3 1 CB A SER 125 ? ? OG A SER 125 ? ? 1.311 1.418 -0.107 0.013 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A ASN 11 ? ? CA A ASN 11 ? ? CB A ASN 11 ? ? 98.28 110.60 -12.32 1.80 N 2 1 C A ASN 11 ? ? N A GLY 12 ? ? CA A GLY 12 ? ? 135.07 122.30 12.77 2.10 Y 3 1 CA A LYS 57 ? ? CB A LYS 57 ? ? CG A LYS 57 ? ? 127.97 113.40 14.57 2.20 N 4 1 CG A GLN 74 ? ? CD A GLN 74 ? ? OE1 A GLN 74 ? ? 98.48 121.60 -23.12 2.00 N 5 1 CB A ASP 75 ? ? CG A ASP 75 ? ? OD1 A ASP 75 ? ? 126.82 118.30 8.52 0.90 N 6 1 CB A TYR 88 ? ? CG A TYR 88 ? ? CD1 A TYR 88 ? ? 117.39 121.00 -3.61 0.60 N 7 1 NE A ARG 89 ? ? CZ A ARG 89 ? ? NH1 A ARG 89 ? ? 125.09 120.30 4.79 0.50 N 8 1 N A SER 125 ? ? CA A SER 125 ? ? CB A SER 125 ? ? 100.38 110.50 -10.12 1.50 N 9 1 CB A GLU 133 ? ? CG A GLU 133 ? ? CD A GLU 133 ? ? 131.76 114.20 17.56 2.70 N 10 1 CB A ASP 139 ? ? CG A ASP 139 ? ? OD2 A ASP 139 ? ? 112.54 118.30 -5.76 0.90 N 11 1 CB A ASP 162 ? ? CG A ASP 162 ? ? OD1 A ASP 162 ? ? 124.51 118.30 6.21 0.90 N 12 1 CA A ARG 173 ? ? CB A ARG 173 ? ? CG A ARG 173 ? ? 137.36 113.40 23.96 2.20 N 13 1 CB A ASP 190 ? ? CG A ASP 190 ? ? OD2 A ASP 190 ? ? 112.52 118.30 -5.78 0.90 N 14 1 OE1 A GLU 221 ? ? CD A GLU 221 ? ? OE2 A GLU 221 ? ? 113.57 123.30 -9.73 1.20 N 15 1 CD A ARG 227 ? ? NE A ARG 227 ? ? CZ A ARG 227 ? ? 135.77 123.60 12.17 1.40 N 16 1 NE A ARG 227 ? ? CZ A ARG 227 ? ? NH1 A ARG 227 ? ? 123.85 120.30 3.55 0.50 N 17 1 NE A ARG 227 ? ? CZ A ARG 227 ? ? NH2 A ARG 227 ? ? 115.29 120.30 -5.01 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 8 ? ? -64.39 -177.13 2 1 LYS A 57 ? ? -123.58 -58.46 3 1 ASP A 75 ? ? -98.56 33.33 4 1 ASN A 244 ? ? -158.98 37.04 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id GLN _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 74 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.219 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_entry_details.entry_id 2CAB _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;RESIDUE 74 IN THIS ENTRY IS IDENTIFIED AS GLN. HOWEVER, CHEMICAL SEQUENCE AND RECENT DIFFRACTION STUDIES ON AN INHIBITOR COMPLEX INDICATE THAT IT SHOULD BE ASP. ; _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A ASP 4 ? A ASP 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _atom_sites.entry_id 2CAB _atom_sites.fract_transf_matrix[1][1] .012270 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] .013590 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] .026950 _atom_sites.fract_transf_vector[1] -.02494 _atom_sites.fract_transf_vector[2] -.33832 _atom_sites.fract_transf_vector[3] .62129 # loop_ _atom_sites_footnote.id _atom_sites_footnote.text 1 'RESIDUES 30 AND 202 ARE CIS-PROLINES.' 2 'CYSTINE 212 IS MODIFIABLE BY MERCURIALS.' 3 'HISTIDINE RESIDUES 94, 96 AND 119 ARE ZINC LIGANDS.' 4 'HISTIDINE RESIDUES 64, 67 AND 200 ARE IN THE ACTIVE SITE.' 5 'SEE REMARK 7.' # loop_ _atom_type.symbol C N O S ZN # loop_