data_2CKU # _entry.id 2CKU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.344 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2CKU PDBE EBI-28510 WWPDB D_1290028510 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1E88 unspecified 'SOLUTION STRUCTURE OF 6F11F22F2, A COMPACT THREE-MODULE FRAGMENT OF THE GELATIN-BINDING DOMAIN OF HUMAN FIBRONECTIN' PDB 1E8B unspecified 'SOLUTION STRUCTURE OF 6F11F22F2, A COMPACT THREE-MODULE FRAGMENT OF THE GELATIN-BINDING DOMAIN OF HUMAN FIBRONECTIN' PDB 1FBR unspecified 'FOURTH AND FIFTH FIBRONECTIN TYPE I MODULE PAIR' PDB 1FNA unspecified 'FIBRONECTIN CELL-ADHESION MODULE TYPE III-10' PDB 1FNF unspecified 'FRAGMENT OF HUMAN FIBRONECTIN ENCOMPASSING TYPE-III REPEATS 7 THROUGH 10' PDB 1FNH unspecified 'CRYSTAL STRUCTURE OF HEPARIN AND INTEGRIN BINDING SEGMENT OF HUMAN FIBRONECTIN' PDB 1J8K unspecified 'NMR STRUCTURE OF THE FIBRONECTIN EDA DOMAIN , NMR, 20STRUCTURES' PDB 1O9A unspecified 'SOLUTION STRUCTURE OF THE COMPLEX OF 1F12F1 FROM FIBRONECTIN WITH B3 FROM FNBB FROM S. DYSGALACTIAE' PDB 1OWW unspecified 'SOLUTION STRUCTURE OF THE FIRST TYPE III MODULE OF HUMANFIBRONECTIN DETERMINED BY 1H, 15N NMR SPECTROSCOPY' PDB 1Q38 unspecified ANASTELLIN PDB 1QGB unspecified 'SOLUTION STRUCTURE OF THE N-TERMINAL F1 MODULE PAIR FROM HUMAN FIBRONECTIN' PDB 1QO6 unspecified 'SOLUTION STRUCTURE OF A PAIR OF MODULES FROM THE GELATIN-BINDING DOMAIN OF FIBRONECTIN' PDB 1TTF unspecified 'FIBRONECTIN (TENTH TYPE III MODULE) (NMR, 36 STRUCTURES)' PDB 1TTG unspecified 'FIBRONECTIN (TENTH TYPE III MODULE) (NMR, RESTRAINED MINIMIZED AVERAGE STRUCTURE)' PDB 2CG6 unspecified 'SECOND AND THIRD FIBRONECTIN TYPE I MODULE PAIR (CRYSTAL FORM I)' PDB 2CG7 unspecified 'SECOND AND THIRD FIBRONECTIN TYPE I MODULE PAIR (CRYSTAL FORM II).' PDB 2FN2 unspecified 'SOLUTION NMR STRUCTURE OF THE GLYCOSYLATED SECOND TYPE TWO MODULE OF FIBRONECTIN, 20 STRUCTURES' PDB 2FNB unspecified 'NMR STRUCTURE OF THE FIBRONECTIN ED-B DOMAIN, NMR, 20 STRUCTURES' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CKU _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2006-04-21 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Werner, J.M.' 1 'Potts, J.R.' 2 # _citation.id primary _citation.title ;The Solution and Crystal Structures of a Module Pair from the Staphylococcus Aureus-Binding Site of Human Fibronectin-A Tale with a Twist. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 368 _citation.page_first 833 _citation.page_last ? _citation.year 2007 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17368672 _citation.pdbx_database_id_DOI 10.1016/J.JMB.2007.02.061 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rudino-Pinera, E.' 1 ? primary 'Ravelli, R.B.G.' 2 ? primary 'Sheldrick, G.M.' 3 ? primary 'Nanao, M.H.' 4 ? primary 'Korostelev, V.V.' 5 ? primary 'Werner, J.M.' 6 ? primary 'Schwarz-Linek, U.' 7 ? primary 'Potts, J.R.' 8 ? primary 'Garman, E.F.' 9 ? # _cell.entry_id 2CKU _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2CKU _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description FIBRONECTIN _entity.formula_weight 10120.389 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment '2ND AND 3RD F1 MODULES, RESIDUES 93-182 (62-151 IN COORDINATES)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FN, COLD-INSOLUBE GLOBULIN, CIG' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGN GKGEWTCKPI ; _entity_poly.pdbx_seq_one_letter_code_can ;AEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGN GKGEWTCKPI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 GLU n 1 4 THR n 1 5 CYS n 1 6 PHE n 1 7 ASP n 1 8 LYS n 1 9 TYR n 1 10 THR n 1 11 GLY n 1 12 ASN n 1 13 THR n 1 14 TYR n 1 15 ARG n 1 16 VAL n 1 17 GLY n 1 18 ASP n 1 19 THR n 1 20 TYR n 1 21 GLU n 1 22 ARG n 1 23 PRO n 1 24 LYS n 1 25 ASP n 1 26 SER n 1 27 MET n 1 28 ILE n 1 29 TRP n 1 30 ASP n 1 31 CYS n 1 32 THR n 1 33 CYS n 1 34 ILE n 1 35 GLY n 1 36 ALA n 1 37 GLY n 1 38 ARG n 1 39 GLY n 1 40 ARG n 1 41 ILE n 1 42 SER n 1 43 CYS n 1 44 THR n 1 45 ILE n 1 46 ALA n 1 47 ASN n 1 48 ARG n 1 49 CYS n 1 50 HIS n 1 51 GLU n 1 52 GLY n 1 53 GLY n 1 54 GLN n 1 55 SER n 1 56 TYR n 1 57 LYS n 1 58 ILE n 1 59 GLY n 1 60 ASP n 1 61 THR n 1 62 TRP n 1 63 ARG n 1 64 ARG n 1 65 PRO n 1 66 HIS n 1 67 GLU n 1 68 THR n 1 69 GLY n 1 70 GLY n 1 71 TYR n 1 72 MET n 1 73 LEU n 1 74 GLU n 1 75 CYS n 1 76 VAL n 1 77 CYS n 1 78 LEU n 1 79 GLY n 1 80 ASN n 1 81 GLY n 1 82 LYS n 1 83 GLY n 1 84 GLU n 1 85 TRP n 1 86 THR n 1 87 CYS n 1 88 LYS n 1 89 PRO n 1 90 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'PICHIA PASTORIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FINC_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P02751 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CKU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 90 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02751 _struct_ref_seq.db_align_beg 93 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 182 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 62 _struct_ref_seq.pdbx_auth_seq_align_end 151 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH ? _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 600 ? 2 'AVANCE II' Bruker 700 ? # _pdbx_nmr_refine.entry_id 2CKU _pdbx_nmr_refine.method CNS _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE. STRUCTURES ARE OVERLAYED ON SECONDARY STRUCTURE OF 2F1.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2CKU _pdbx_nmr_details.text ;THE STRUCTURE WAS DETERMINED USING A UNLABELLED, 15N-LABELLED AND 15N,13C-LABELLED 2F13F1 AND USING DATA FROM HOMONUCLEAR 2D, 15N-3D AND TRIPLE-RESONANCE 3D EXPERIMENTS. ; # _pdbx_nmr_ensemble.entry_id 2CKU _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION' # _pdbx_nmr_representative.entry_id 2CKU _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' NMRView ? ? 2 # _exptl.entry_id 2CKU _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CKU _struct.title 'Solution structure of 2F13F1 from human fibronectin' _struct.pdbx_descriptor FIBRONECTIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CKU _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;GLYCOPROTEIN, CELL ADHESION, PHOSPHORYLATION, PYRROLIDONE CARBOXYLIC ACID, SIGNALING PROTEIN, SULFATION, ACUTE PHASE, FIBRONECTIN, MODULE PAIR, HEPARIN-BINDING, ALTERNATIVE SPLICING ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 66 A CYS 94 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 43 SG ? ? A CYS 92 A CYS 104 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf3 disulf ? ? A CYS 49 SG ? ? ? 1_555 A CYS 77 SG ? ? A CYS 110 A CYS 138 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf4 disulf ? ? A CYS 75 SG ? ? ? 1_555 A CYS 87 SG ? ? A CYS 136 A CYS 148 1_555 ? ? ? ? ? ? ? 2.036 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 2 ? AB ? 3 ? AC ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AC 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 THR A 4 ? PHE A 6 ? THR A 65 PHE A 67 AA 2 THR A 13 ? ARG A 15 ? THR A 74 ARG A 76 AB 1 THR A 19 ? PRO A 23 ? THR A 80 PRO A 84 AB 2 ILE A 28 ? ILE A 34 ? ILE A 89 ILE A 95 AB 3 ARG A 40 ? ILE A 45 ? ARG A 101 ILE A 106 AC 1 CYS A 75 ? LEU A 78 ? CYS A 136 LEU A 139 AC 2 GLU A 84 ? CYS A 87 ? GLU A 145 CYS A 148 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N CYS A 5 ? N CYS A 66 O TYR A 14 ? O TYR A 75 AB 1 2 N ARG A 22 ? N ARG A 83 O TRP A 29 ? O TRP A 90 AB 2 3 N ILE A 34 ? N ILE A 95 O ARG A 40 ? O ARG A 101 AC 1 2 N LEU A 78 ? N LEU A 139 O GLU A 84 ? O GLU A 145 # _database_PDB_matrix.entry_id 2CKU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CKU _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 62 ? ? ? A . n A 1 2 GLU 2 63 63 GLU GLU A . n A 1 3 GLU 3 64 64 GLU GLU A . n A 1 4 THR 4 65 65 THR THR A . n A 1 5 CYS 5 66 66 CYS CYS A . n A 1 6 PHE 6 67 67 PHE PHE A . n A 1 7 ASP 7 68 68 ASP ASP A . n A 1 8 LYS 8 69 69 LYS LYS A . n A 1 9 TYR 9 70 70 TYR TYR A . n A 1 10 THR 10 71 71 THR THR A . n A 1 11 GLY 11 72 72 GLY GLY A . n A 1 12 ASN 12 73 73 ASN ASN A . n A 1 13 THR 13 74 74 THR THR A . n A 1 14 TYR 14 75 75 TYR TYR A . n A 1 15 ARG 15 76 76 ARG ARG A . n A 1 16 VAL 16 77 77 VAL VAL A . n A 1 17 GLY 17 78 78 GLY GLY A . n A 1 18 ASP 18 79 79 ASP ASP A . n A 1 19 THR 19 80 80 THR THR A . n A 1 20 TYR 20 81 81 TYR TYR A . n A 1 21 GLU 21 82 82 GLU GLU A . n A 1 22 ARG 22 83 83 ARG ARG A . n A 1 23 PRO 23 84 84 PRO PRO A . n A 1 24 LYS 24 85 85 LYS LYS A . n A 1 25 ASP 25 86 86 ASP ASP A . n A 1 26 SER 26 87 87 SER SER A . n A 1 27 MET 27 88 88 MET MET A . n A 1 28 ILE 28 89 89 ILE ILE A . n A 1 29 TRP 29 90 90 TRP TRP A . n A 1 30 ASP 30 91 91 ASP ASP A . n A 1 31 CYS 31 92 92 CYS CYS A . n A 1 32 THR 32 93 93 THR THR A . n A 1 33 CYS 33 94 94 CYS CYS A . n A 1 34 ILE 34 95 95 ILE ILE A . n A 1 35 GLY 35 96 96 GLY GLY A . n A 1 36 ALA 36 97 97 ALA ALA A . n A 1 37 GLY 37 98 98 GLY GLY A . n A 1 38 ARG 38 99 99 ARG ARG A . n A 1 39 GLY 39 100 100 GLY GLY A . n A 1 40 ARG 40 101 101 ARG ARG A . n A 1 41 ILE 41 102 102 ILE ILE A . n A 1 42 SER 42 103 103 SER SER A . n A 1 43 CYS 43 104 104 CYS CYS A . n A 1 44 THR 44 105 105 THR THR A . n A 1 45 ILE 45 106 106 ILE ILE A . n A 1 46 ALA 46 107 107 ALA ALA A . n A 1 47 ASN 47 108 108 ASN ASN A . n A 1 48 ARG 48 109 109 ARG ARG A . n A 1 49 CYS 49 110 110 CYS CYS A . n A 1 50 HIS 50 111 111 HIS HIS A . n A 1 51 GLU 51 112 112 GLU GLU A . n A 1 52 GLY 52 113 113 GLY GLY A . n A 1 53 GLY 53 114 114 GLY GLY A . n A 1 54 GLN 54 115 115 GLN GLN A . n A 1 55 SER 55 116 116 SER SER A . n A 1 56 TYR 56 117 117 TYR TYR A . n A 1 57 LYS 57 118 118 LYS LYS A . n A 1 58 ILE 58 119 119 ILE ILE A . n A 1 59 GLY 59 120 120 GLY GLY A . n A 1 60 ASP 60 121 121 ASP ASP A . n A 1 61 THR 61 122 122 THR THR A . n A 1 62 TRP 62 123 123 TRP TRP A . n A 1 63 ARG 63 124 124 ARG ARG A . n A 1 64 ARG 64 125 125 ARG ARG A . n A 1 65 PRO 65 126 126 PRO PRO A . n A 1 66 HIS 66 127 127 HIS HIS A . n A 1 67 GLU 67 128 128 GLU GLU A . n A 1 68 THR 68 129 129 THR THR A . n A 1 69 GLY 69 130 130 GLY GLY A . n A 1 70 GLY 70 131 131 GLY GLY A . n A 1 71 TYR 71 132 132 TYR TYR A . n A 1 72 MET 72 133 133 MET MET A . n A 1 73 LEU 73 134 134 LEU LEU A . n A 1 74 GLU 74 135 135 GLU GLU A . n A 1 75 CYS 75 136 136 CYS CYS A . n A 1 76 VAL 76 137 137 VAL VAL A . n A 1 77 CYS 77 138 138 CYS CYS A . n A 1 78 LEU 78 139 139 LEU LEU A . n A 1 79 GLY 79 140 140 GLY GLY A . n A 1 80 ASN 80 141 141 ASN ASN A . n A 1 81 GLY 81 142 142 GLY GLY A . n A 1 82 LYS 82 143 143 LYS LYS A . n A 1 83 GLY 83 144 144 GLY GLY A . n A 1 84 GLU 84 145 145 GLU GLU A . n A 1 85 TRP 85 146 146 TRP TRP A . n A 1 86 THR 86 147 147 THR THR A . n A 1 87 CYS 87 148 148 CYS CYS A . n A 1 88 LYS 88 149 149 LYS LYS A . n A 1 89 PRO 89 150 150 PRO PRO A . n A 1 90 ILE 90 151 151 ILE ILE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-04-03 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-08-21 5 'Structure model' 1 4 2021-06-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_nmr_software 2 4 'Structure model' pdbx_nmr_spectrometer 3 5 'Structure model' pdbx_nmr_representative 4 5 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_nmr_software.name' 2 4 'Structure model' '_pdbx_nmr_spectrometer.manufacturer' 3 5 'Structure model' '_pdbx_nmr_representative.selection_criteria' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 H A CYS 66 ? ? O A TYR 75 ? ? 1.58 2 12 H A CYS 66 ? ? O A TYR 75 ? ? 1.57 3 13 H A GLY 78 ? ? O A CYS 94 ? ? 1.59 4 13 H A CYS 66 ? ? O A TYR 75 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 86 ? ? 46.55 73.23 2 1 ALA A 97 ? ? 70.99 114.54 3 1 HIS A 111 ? ? -135.10 -143.28 4 1 GLU A 112 ? ? 89.80 175.95 5 1 TRP A 123 ? ? -141.28 55.21 6 1 ARG A 124 ? ? -55.66 98.23 7 1 PRO A 126 ? ? -39.71 177.97 8 1 LYS A 143 ? ? -160.77 -54.18 9 2 ASP A 86 ? ? 48.32 77.51 10 2 ARG A 99 ? ? -133.88 -67.54 11 2 ILE A 106 ? ? -45.37 155.86 12 2 GLU A 112 ? ? 167.30 138.15 13 2 ARG A 124 ? ? -53.33 102.85 14 2 PRO A 126 ? ? -40.28 174.07 15 2 LYS A 143 ? ? -144.50 -44.59 16 3 ASP A 86 ? ? 42.51 74.31 17 3 ALA A 97 ? ? -170.85 55.67 18 3 ARG A 99 ? ? -175.93 -26.89 19 3 ASN A 108 ? ? -93.28 59.25 20 3 GLU A 112 ? ? 170.90 166.82 21 3 PRO A 126 ? ? -43.15 178.61 22 3 LYS A 143 ? ? -144.52 43.36 23 4 LYS A 69 ? ? -48.97 -17.98 24 4 ASP A 86 ? ? 37.30 69.10 25 4 ALA A 97 ? ? 62.42 110.05 26 4 GLU A 112 ? ? 167.35 140.05 27 4 PRO A 126 ? ? -41.08 179.97 28 4 LYS A 143 ? ? -147.67 -66.65 29 5 ASP A 86 ? ? 40.71 74.27 30 5 ALA A 97 ? ? 65.76 150.21 31 5 ASN A 108 ? ? -93.33 43.79 32 5 GLU A 112 ? ? 165.41 126.82 33 5 PRO A 126 ? ? -43.00 179.50 34 5 MET A 133 ? ? -57.72 107.20 35 6 ASP A 86 ? ? 55.65 -77.02 36 6 SER A 87 ? ? -158.26 30.94 37 6 ILE A 95 ? ? -105.74 74.70 38 6 ALA A 97 ? ? -158.65 45.56 39 6 ARG A 99 ? ? -170.14 -37.58 40 6 HIS A 111 ? ? -134.94 -140.70 41 6 GLU A 112 ? ? 89.20 163.94 42 6 PRO A 126 ? ? -41.93 178.83 43 7 ASP A 86 ? ? 49.42 77.29 44 7 ALA A 97 ? ? -160.54 119.88 45 7 ILE A 106 ? ? -43.57 155.23 46 7 GLU A 112 ? ? 171.88 159.54 47 7 ASN A 141 ? ? -146.19 34.83 48 7 LYS A 143 ? ? -163.63 -54.40 49 8 ASP A 86 ? ? 33.91 57.00 50 8 ARG A 99 ? ? -149.11 48.84 51 8 GLU A 112 ? ? 172.09 -66.79 52 8 PRO A 126 ? ? -41.23 171.82 53 8 MET A 133 ? ? -56.52 106.73 54 8 LYS A 143 ? ? -160.60 -48.53 55 9 ASP A 86 ? ? 59.33 -72.61 56 9 SER A 87 ? ? -165.11 38.39 57 9 ARG A 99 ? ? -148.84 54.14 58 9 ASN A 108 ? ? -91.09 52.78 59 9 GLU A 112 ? ? 167.66 141.29 60 9 PRO A 126 ? ? -41.01 172.85 61 9 LYS A 143 ? ? -164.14 -54.97 62 10 ASP A 86 ? ? 67.06 -67.88 63 10 SER A 87 ? ? -162.94 31.54 64 10 ILE A 106 ? ? -49.02 152.16 65 10 GLU A 112 ? ? 169.11 152.37 66 10 PRO A 126 ? ? -43.01 176.63 67 10 LYS A 143 ? ? -130.08 -42.75 68 11 ASP A 86 ? ? 49.53 77.87 69 11 ARG A 99 ? ? -151.40 -87.43 70 11 GLU A 112 ? ? 170.68 -51.27 71 11 GLN A 115 ? ? -61.89 -177.54 72 11 ARG A 124 ? ? -66.09 90.08 73 11 PRO A 126 ? ? -43.92 178.19 74 11 ASN A 141 ? ? 70.88 -64.79 75 11 LYS A 143 ? ? -154.93 68.19 76 12 ASP A 86 ? ? 47.65 79.84 77 12 ARG A 99 ? ? -166.65 67.14 78 12 ILE A 106 ? ? -69.41 -168.73 79 12 ALA A 107 ? ? 70.68 -164.93 80 12 ASN A 108 ? ? 82.33 -25.99 81 12 GLU A 112 ? ? 169.41 123.95 82 12 PRO A 126 ? ? -39.06 149.36 83 12 LYS A 143 ? ? -171.31 -43.96 84 13 ARG A 99 ? ? -114.82 -88.04 85 13 HIS A 111 ? ? -133.75 -145.41 86 13 GLU A 112 ? ? 89.23 163.74 87 13 TRP A 123 ? ? -143.80 40.11 88 13 ARG A 124 ? ? -55.77 108.06 89 13 PRO A 126 ? ? -41.36 -175.53 90 13 ASN A 141 ? ? 68.65 -70.37 91 14 ASP A 86 ? ? 35.21 63.86 92 14 GLU A 112 ? ? 170.32 157.72 93 14 PRO A 126 ? ? -39.77 144.75 94 15 LYS A 69 ? ? -49.39 -19.00 95 15 ASP A 86 ? ? 35.31 71.23 96 15 ALA A 97 ? ? 17.42 94.04 97 15 GLU A 112 ? ? 171.35 147.37 98 15 PRO A 126 ? ? -44.08 175.34 99 15 MET A 133 ? ? -50.41 108.63 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 62 ? A ALA 1 2 2 Y 1 A ALA 62 ? A ALA 1 3 3 Y 1 A ALA 62 ? A ALA 1 4 4 Y 1 A ALA 62 ? A ALA 1 5 5 Y 1 A ALA 62 ? A ALA 1 6 6 Y 1 A ALA 62 ? A ALA 1 7 7 Y 1 A ALA 62 ? A ALA 1 8 8 Y 1 A ALA 62 ? A ALA 1 9 9 Y 1 A ALA 62 ? A ALA 1 10 10 Y 1 A ALA 62 ? A ALA 1 11 11 Y 1 A ALA 62 ? A ALA 1 12 12 Y 1 A ALA 62 ? A ALA 1 13 13 Y 1 A ALA 62 ? A ALA 1 14 14 Y 1 A ALA 62 ? A ALA 1 15 15 Y 1 A ALA 62 ? A ALA 1 #