data_2COU # _entry.id 2COU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2COU pdb_00002cou 10.2210/pdb2cou/pdb RCSB RCSB024462 ? ? WWPDB D_1000024462 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmi002020893.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2COU _pdbx_database_status.recvd_initial_deposition_date 2005-05-18 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nagashima, T.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the second BRCT domain of epithelial cell transforming 2' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nagashima, T.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ECT2 protein' _entity.formula_weight 12146.516 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'BRCA1 C-turminus (BRCT) domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Epithelial cell transforming sequence 2 oncogene' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGFKVPPFQDCILSFLGFSDEEKHSMEEMTEMQGGSYLPVGDERCTHLIVEENTVKDLPFEPSKKLFVVKQEWFW GSIQMDARAGETMYLYEKANTPESGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGFKVPPFQDCILSFLGFSDEEKHSMEEMTEMQGGSYLPVGDERCTHLIVEENTVKDLPFEPSKKLFVVKQEWFW GSIQMDARAGETMYLYEKANTPESGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmi002020893.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PHE n 1 9 LYS n 1 10 VAL n 1 11 PRO n 1 12 PRO n 1 13 PHE n 1 14 GLN n 1 15 ASP n 1 16 CYS n 1 17 ILE n 1 18 LEU n 1 19 SER n 1 20 PHE n 1 21 LEU n 1 22 GLY n 1 23 PHE n 1 24 SER n 1 25 ASP n 1 26 GLU n 1 27 GLU n 1 28 LYS n 1 29 HIS n 1 30 SER n 1 31 MET n 1 32 GLU n 1 33 GLU n 1 34 MET n 1 35 THR n 1 36 GLU n 1 37 MET n 1 38 GLN n 1 39 GLY n 1 40 GLY n 1 41 SER n 1 42 TYR n 1 43 LEU n 1 44 PRO n 1 45 VAL n 1 46 GLY n 1 47 ASP n 1 48 GLU n 1 49 ARG n 1 50 CYS n 1 51 THR n 1 52 HIS n 1 53 LEU n 1 54 ILE n 1 55 VAL n 1 56 GLU n 1 57 GLU n 1 58 ASN n 1 59 THR n 1 60 VAL n 1 61 LYS n 1 62 ASP n 1 63 LEU n 1 64 PRO n 1 65 PHE n 1 66 GLU n 1 67 PRO n 1 68 SER n 1 69 LYS n 1 70 LYS n 1 71 LEU n 1 72 PHE n 1 73 VAL n 1 74 VAL n 1 75 LYS n 1 76 GLN n 1 77 GLU n 1 78 TRP n 1 79 PHE n 1 80 TRP n 1 81 GLY n 1 82 SER n 1 83 ILE n 1 84 GLN n 1 85 MET n 1 86 ASP n 1 87 ALA n 1 88 ARG n 1 89 ALA n 1 90 GLY n 1 91 GLU n 1 92 THR n 1 93 MET n 1 94 TYR n 1 95 LEU n 1 96 TYR n 1 97 GLU n 1 98 LYS n 1 99 ALA n 1 100 ASN n 1 101 THR n 1 102 PRO n 1 103 GLU n 1 104 SER n 1 105 GLY n 1 106 PRO n 1 107 SER n 1 108 SER n 1 109 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041018-12 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ECT2_MOUSE _struct_ref.pdbx_db_accession Q07139 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;FKVPPFQDCILSFLGFSDEEKHSMEEMTEMQGGSYLPVGDERCTHLIVEENTVKDLPFEPSKKLFVVKQEWFWGSIQMDA RAGETMYLYEKANTPE ; _struct_ref.pdbx_align_begin 91 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2COU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 103 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q07139 _struct_ref_seq.db_align_beg 91 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 186 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 103 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2COU GLY A 1 ? UNP Q07139 ? ? 'cloning artifact' 1 1 1 2COU SER A 2 ? UNP Q07139 ? ? 'cloning artifact' 2 2 1 2COU SER A 3 ? UNP Q07139 ? ? 'cloning artifact' 3 3 1 2COU GLY A 4 ? UNP Q07139 ? ? 'cloning artifact' 4 4 1 2COU SER A 5 ? UNP Q07139 ? ? 'cloning artifact' 5 5 1 2COU SER A 6 ? UNP Q07139 ? ? 'cloning artifact' 6 6 1 2COU GLY A 7 ? UNP Q07139 ? ? 'cloning artifact' 7 7 1 2COU SER A 104 ? UNP Q07139 ? ? 'cloning artifact' 104 8 1 2COU GLY A 105 ? UNP Q07139 ? ? 'cloning artifact' 105 9 1 2COU PRO A 106 ? UNP Q07139 ? ? 'cloning artifact' 106 10 1 2COU SER A 107 ? UNP Q07139 ? ? 'cloning artifact' 107 11 1 2COU SER A 108 ? UNP Q07139 ? ? 'cloning artifact' 108 12 1 2COU GLY A 109 ? UNP Q07139 ? ? 'cloning artifact' 109 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.02mM BRCT domain U-13C,15N; 20mM TrisHCl, 100mM NaCl, 1mM DTT, 0.02% NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2COU _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2COU _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2COU _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20020425 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.901 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2COU _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2COU _struct.title 'Solution structure of the second BRCT domain of epithelial cell transforming 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2COU _struct_keywords.pdbx_keywords 'CELL CYCLE' _struct_keywords.text ;BRCT domain, ECT2, Rho GTPase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL CYCLE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 24 ? GLY A 39 ? SER A 24 GLY A 39 1 ? 16 HELX_P HELX_P2 2 LYS A 75 ? MET A 85 ? LYS A 75 MET A 85 1 ? 11 HELX_P HELX_P3 3 GLY A 90 ? TYR A 94 ? GLY A 90 TYR A 94 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 18 ? LEU A 21 ? LEU A 18 LEU A 21 A 2 HIS A 52 ? VAL A 55 ? HIS A 52 VAL A 55 A 3 PHE A 72 ? VAL A 74 ? PHE A 72 VAL A 74 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 19 ? N SER A 19 O ILE A 54 ? O ILE A 54 A 2 3 N LEU A 53 ? N LEU A 53 O VAL A 74 ? O VAL A 74 # _database_PDB_matrix.entry_id 2COU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2COU _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 GLY 109 109 109 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-18 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? -103.70 77.27 2 1 ASP A 25 ? ? -38.72 -26.88 3 1 LYS A 98 ? ? 37.73 36.11 4 2 ASP A 25 ? ? -35.13 -34.89 5 2 SER A 82 ? ? -35.00 -36.70 6 3 ASP A 47 ? ? -46.69 169.27 7 3 THR A 59 ? ? -130.32 -32.63 8 3 LYS A 61 ? ? -132.88 -54.58 9 3 SER A 82 ? ? -34.87 -38.03 10 3 THR A 92 ? ? -48.90 -19.75 11 3 LYS A 98 ? ? -86.46 41.85 12 3 PRO A 106 ? ? -69.75 -175.02 13 4 PHE A 23 ? ? -48.45 155.59 14 4 THR A 35 ? ? -38.37 -31.65 15 4 ASP A 47 ? ? -49.34 172.34 16 4 SER A 82 ? ? -35.45 -33.23 17 4 ARG A 88 ? ? -59.92 97.49 18 4 GLU A 97 ? ? -96.62 42.13 19 4 ALA A 99 ? ? -57.81 104.69 20 5 GLN A 14 ? ? -34.94 116.88 21 5 ASP A 25 ? ? -35.99 -34.25 22 5 THR A 35 ? ? -37.29 -30.41 23 5 ARG A 49 ? ? -35.46 -37.95 24 5 ASN A 58 ? ? -38.92 -26.00 25 5 LYS A 61 ? ? -130.66 -48.54 26 5 LEU A 95 ? ? -50.38 107.74 27 5 GLU A 97 ? ? -108.14 47.73 28 5 LYS A 98 ? ? 35.44 53.03 29 5 PRO A 106 ? ? -69.78 92.46 30 6 ASP A 25 ? ? -33.70 -39.19 31 6 ARG A 49 ? ? -37.13 -30.47 32 6 SER A 82 ? ? -37.22 -35.86 33 6 ARG A 88 ? ? -57.85 104.34 34 6 GLU A 97 ? ? -80.44 49.63 35 6 LYS A 98 ? ? 34.34 43.17 36 6 GLU A 103 ? ? 71.27 39.77 37 6 PRO A 106 ? ? -69.75 2.81 38 6 SER A 107 ? ? -34.65 141.48 39 6 SER A 108 ? ? 70.16 38.10 40 7 SER A 6 ? ? -49.24 161.53 41 7 LYS A 9 ? ? -170.32 143.59 42 7 ASP A 25 ? ? -34.96 -33.64 43 7 SER A 82 ? ? -35.27 -36.40 44 7 LYS A 98 ? ? -87.51 48.61 45 7 ALA A 99 ? ? -127.18 -60.66 46 7 SER A 107 ? ? -126.58 -52.76 47 8 GLN A 14 ? ? -39.73 124.39 48 8 ASP A 15 ? ? 39.94 50.09 49 8 LYS A 61 ? ? -98.29 -60.13 50 8 SER A 82 ? ? -38.05 -37.65 51 8 TYR A 96 ? ? -69.31 95.61 52 8 LYS A 98 ? ? -94.54 42.90 53 9 VAL A 45 ? ? -39.91 138.78 54 9 ARG A 49 ? ? -39.71 -34.70 55 9 SER A 82 ? ? -37.15 -38.27 56 9 ARG A 88 ? ? -59.24 102.90 57 9 TYR A 96 ? ? -69.95 92.74 58 9 SER A 107 ? ? 39.98 40.31 59 10 SER A 6 ? ? -41.68 152.76 60 10 ASP A 25 ? ? -35.88 -33.48 61 10 THR A 35 ? ? -39.12 -39.55 62 10 GLU A 57 ? ? -84.12 32.20 63 10 LYS A 61 ? ? -130.42 -47.18 64 10 GLU A 97 ? ? -101.22 47.14 65 10 LYS A 98 ? ? 34.59 48.39 66 10 THR A 101 ? ? -33.54 147.68 67 10 GLU A 103 ? ? -39.97 137.01 68 11 PHE A 23 ? ? -47.93 169.56 69 11 VAL A 45 ? ? -38.59 144.93 70 11 LYS A 98 ? ? -83.64 43.50 71 11 THR A 101 ? ? -38.58 144.26 72 12 SER A 6 ? ? -42.54 105.67 73 12 MET A 37 ? ? -36.40 -38.39 74 12 SER A 82 ? ? -36.59 -36.04 75 12 GLU A 97 ? ? -94.62 56.88 76 12 LYS A 98 ? ? 34.41 45.56 77 12 SER A 108 ? ? 36.34 40.33 78 13 PHE A 23 ? ? -49.74 157.47 79 13 ASP A 25 ? ? -38.78 -36.29 80 13 THR A 35 ? ? -36.40 -33.43 81 13 ASP A 47 ? ? -48.13 161.21 82 13 ARG A 88 ? ? -61.82 96.99 83 13 THR A 92 ? ? -49.44 -18.14 84 13 TYR A 96 ? ? -62.61 91.88 85 13 SER A 104 ? ? -35.51 125.23 86 14 ASP A 25 ? ? -36.78 -36.72 87 14 THR A 35 ? ? -39.32 -31.79 88 14 THR A 59 ? ? -130.48 -41.12 89 14 SER A 82 ? ? -37.76 -38.06 90 14 SER A 104 ? ? -96.50 -61.88 91 15 GLN A 14 ? ? -38.67 112.48 92 15 GLU A 57 ? ? -84.30 32.96 93 15 ARG A 88 ? ? -59.28 100.78 94 15 LYS A 98 ? ? 34.46 47.05 95 15 PRO A 106 ? ? -69.80 92.90 96 16 GLN A 14 ? ? -39.55 111.02 97 16 ARG A 49 ? ? -36.01 -37.30 98 16 ARG A 88 ? ? -59.91 104.17 99 16 TYR A 96 ? ? -57.47 90.90 100 16 ALA A 99 ? ? -108.76 76.71 101 17 PHE A 23 ? ? -49.81 166.65 102 17 SER A 82 ? ? -38.00 -38.10 103 17 LYS A 98 ? ? -96.48 49.37 104 17 PRO A 106 ? ? -69.80 0.27 105 18 SER A 6 ? ? -95.03 -62.03 106 18 ASP A 25 ? ? -34.45 -38.13 107 18 ASP A 47 ? ? -48.75 166.30 108 18 LYS A 75 ? ? -67.35 -175.19 109 18 SER A 82 ? ? -35.72 -35.19 110 18 LYS A 98 ? ? -94.83 51.45 111 19 SER A 2 ? ? -164.65 115.11 112 19 ASP A 15 ? ? 35.92 41.44 113 19 ASP A 25 ? ? -36.86 -29.31 114 19 THR A 35 ? ? -37.09 -36.84 115 19 SER A 82 ? ? -34.56 -33.23 116 20 ASP A 25 ? ? -33.91 -36.98 117 20 THR A 59 ? ? -127.87 -53.16 118 20 SER A 82 ? ? -34.80 -34.67 119 20 TYR A 96 ? ? -69.98 89.81 120 20 LYS A 98 ? ? -93.80 34.64 121 20 ALA A 99 ? ? -104.80 79.10 122 20 ASN A 100 ? ? -101.60 77.05 123 20 PRO A 106 ? ? -69.73 83.80 124 20 SER A 107 ? ? -58.99 85.46 #