data_2CP9 # _entry.id 2CP9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CP9 pdb_00002cp9 10.2210/pdb2cp9/pdb RCSB RCSB024474 ? ? WWPDB D_1000024474 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002012647.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CP9 _pdbx_database_status.recvd_initial_deposition_date 2005-05-19 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohashi, W.' 1 'Hirota, H.' 2 'Izumi, K.' 3 'Yoshida, M.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of RSGI RUH-042, a UBA domain from human mitochondrial elongation factor Ts' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohashi, W.' 1 ? primary 'Hirota, H.' 2 ? primary 'Izumi, K.' 3 ? primary 'Yoshida, M.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Elongation factor Ts, mitochondrial' _entity.formula_weight 6801.699 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment UBA _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'EF-Ts, EF-TsMt' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGSSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAASGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGSSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAASGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002012647.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 SER n 1 10 LYS n 1 11 GLU n 1 12 LEU n 1 13 LEU n 1 14 MET n 1 15 LYS n 1 16 LEU n 1 17 ARG n 1 18 ARG n 1 19 LYS n 1 20 THR n 1 21 GLY n 1 22 TYR n 1 23 SER n 1 24 PHE n 1 25 VAL n 1 26 ASN n 1 27 CYS n 1 28 LYS n 1 29 LYS n 1 30 ALA n 1 31 LEU n 1 32 GLU n 1 33 THR n 1 34 CYS n 1 35 GLY n 1 36 GLY n 1 37 ASP n 1 38 LEU n 1 39 LYS n 1 40 GLN n 1 41 ALA n 1 42 GLU n 1 43 ILE n 1 44 TRP n 1 45 LEU n 1 46 HIS n 1 47 LYS n 1 48 GLU n 1 49 ALA n 1 50 GLN n 1 51 LYS n 1 52 GLU n 1 53 GLY n 1 54 TRP n 1 55 SER n 1 56 LYS n 1 57 ALA n 1 58 ALA n 1 59 SER n 1 60 GLY n 1 61 PRO n 1 62 SER n 1 63 SER n 1 64 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041220-07 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free (E.coli)' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EFTS_HUMAN _struct_ref.pdbx_db_accession P43897 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAA _struct_ref.pdbx_align_begin 45 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CP9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 58 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P43897 _struct_ref_seq.db_align_beg 45 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 95 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 58 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CP9 GLY A 1 ? UNP P43897 ? ? 'cloning artifact' 1 1 1 2CP9 SER A 2 ? UNP P43897 ? ? 'cloning artifact' 2 2 1 2CP9 SER A 3 ? UNP P43897 ? ? 'cloning artifact' 3 3 1 2CP9 GLY A 4 ? UNP P43897 ? ? 'cloning artifact' 4 4 1 2CP9 SER A 5 ? UNP P43897 ? ? 'cloning artifact' 5 5 1 2CP9 SER A 6 ? UNP P43897 ? ? 'cloning artifact' 6 6 1 2CP9 GLY A 7 ? UNP P43897 ? ? 'cloning artifact' 7 7 1 2CP9 SER A 59 ? UNP P43897 ? ? 'cloning artifact' 59 8 1 2CP9 GLY A 60 ? UNP P43897 ? ? 'cloning artifact' 60 9 1 2CP9 PRO A 61 ? UNP P43897 ? ? 'cloning artifact' 61 10 1 2CP9 SER A 62 ? UNP P43897 ? ? 'cloning artifact' 62 11 1 2CP9 SER A 63 ? UNP P43897 ? ? 'cloning artifact' 63 12 1 2CP9 GLY A 64 ? UNP P43897 ? ? 'cloning artifact' 64 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.23mM RSGI RUH-042 U-13C, 15N; 20mM Tris-HCl U-2H, 100mM NaCl, 1mM DTT U-2H, 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model ECA _pdbx_nmr_spectrometer.manufacturer JEOL _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CP9 _pdbx_nmr_refine.method 'simulated anneling, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2CP9 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_ensemble.entry_id 2CP9 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CP9 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest target function' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection 'Delta NMR' 4.3 JEOL 1 processing NMRPipe 2.1 Delaglio 2 'data analysis' NMRView 5.0.4 Johnson 3 'data analysis' KUJIRA 0.9295 Kobayashi 4 'structure solution' CYANA 2.0.17 Guntert 5 refinement CYANA 2.0.17 Guntert 6 # _exptl.entry_id 2CP9 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CP9 _struct.title 'Solution structure of RSGI RUH-042, a UBA domain from human mitochondrial elongation factor Ts' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CP9 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;UBA, structural genomics, human, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 10 ? GLY A 21 ? LYS A 10 GLY A 21 1 ? 12 HELX_P HELX_P2 2 SER A 23 ? GLY A 35 ? SER A 23 GLY A 35 1 ? 13 HELX_P HELX_P3 3 ASP A 37 ? GLY A 53 ? ASP A 37 GLY A 53 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2CP9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CP9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLY 64 64 64 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-19 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -65.53 96.58 2 1 TRP A 44 ? ? -56.25 -72.44 3 1 ALA A 57 ? ? -36.33 147.73 4 2 SER A 3 ? ? -48.53 103.20 5 2 TYR A 22 ? ? -44.10 159.97 6 2 SER A 23 ? ? -47.83 176.11 7 2 CYS A 34 ? ? -99.34 43.47 8 3 SER A 2 ? ? -37.00 119.19 9 3 LYS A 29 ? ? -76.63 -71.85 10 3 LYS A 56 ? ? -125.55 -58.15 11 4 SER A 9 ? ? -82.48 41.33 12 4 SER A 23 ? ? -44.58 168.86 13 4 CYS A 34 ? ? -79.00 -72.46 14 4 LYS A 51 ? ? -74.94 -70.06 15 4 SER A 55 ? ? -42.22 161.06 16 5 TYR A 22 ? ? -40.35 153.58 17 5 ASN A 26 ? ? -67.73 -70.41 18 5 LYS A 29 ? ? -73.59 -71.65 19 5 ALA A 30 ? ? -39.56 -39.73 20 6 SER A 2 ? ? -51.33 98.97 21 6 LEU A 38 ? ? -34.23 -38.53 22 6 TRP A 44 ? ? -67.43 -70.39 23 6 TRP A 54 ? ? -83.10 44.01 24 6 ALA A 58 ? ? -69.29 92.59 25 7 SER A 23 ? ? -44.91 156.41 26 7 ASP A 37 ? ? -117.87 76.57 27 7 SER A 63 ? ? 36.05 48.60 28 8 TYR A 22 ? ? -45.65 171.64 29 8 TRP A 54 ? ? -68.27 88.23 30 8 PRO A 61 ? ? -69.73 2.77 31 8 SER A 63 ? ? -104.49 -64.68 32 9 SER A 5 ? ? -69.82 89.60 33 9 LYS A 29 ? ? -73.04 -71.09 34 9 ASP A 37 ? ? -118.86 76.93 35 9 SER A 59 ? ? -113.56 79.87 36 10 SER A 3 ? ? -54.02 107.79 37 10 SER A 5 ? ? -53.23 171.14 38 10 SER A 8 ? ? -37.92 137.97 39 10 TYR A 22 ? ? -37.50 146.45 40 11 SER A 8 ? ? -51.10 107.41 41 11 SER A 9 ? ? -81.36 48.83 42 11 SER A 62 ? ? -37.61 140.62 43 12 SER A 23 ? ? -42.94 150.73 44 12 PRO A 61 ? ? -69.82 -177.48 45 13 SER A 3 ? ? -38.75 -39.63 46 13 LYS A 10 ? ? -101.09 -61.57 47 13 TYR A 22 ? ? -43.71 166.08 48 13 SER A 23 ? ? -46.55 173.64 49 14 SER A 23 ? ? -37.62 156.44 50 15 SER A 6 ? ? -59.98 176.77 51 15 SER A 9 ? ? -37.62 120.59 52 15 LYS A 10 ? ? -121.37 -68.46 53 15 TRP A 54 ? ? -99.95 -60.06 54 15 LYS A 56 ? ? -85.74 38.68 55 16 TYR A 22 ? ? -48.19 157.25 56 16 LYS A 29 ? ? -71.63 -71.45 57 16 ASP A 37 ? ? -100.66 76.63 58 16 SER A 55 ? ? -40.56 102.34 59 17 SER A 2 ? ? -82.55 45.11 60 17 SER A 9 ? ? -87.67 40.98 61 17 SER A 59 ? ? -102.68 42.27 62 18 LYS A 10 ? ? -73.13 -70.99 63 18 SER A 23 ? ? -35.61 149.70 64 18 LYS A 29 ? ? -75.23 -71.15 65 18 ASP A 37 ? ? -104.94 78.40 66 18 ALA A 41 ? ? -33.73 -39.74 67 18 PRO A 61 ? ? -69.77 86.54 68 19 SER A 5 ? ? -37.46 129.54 69 19 GLU A 11 ? ? -54.19 -75.21 70 19 LEU A 12 ? ? -37.66 -39.61 71 19 TYR A 22 ? ? -47.46 172.91 72 19 VAL A 25 ? ? -34.34 -36.31 73 19 LYS A 29 ? ? -76.49 -70.98 74 19 ALA A 30 ? ? -38.19 -38.44 75 19 LYS A 51 ? ? -83.12 -74.16 76 19 ALA A 57 ? ? 74.05 44.56 77 20 TYR A 22 ? ? -45.76 161.59 78 20 CYS A 34 ? ? -71.28 -73.89 79 20 ASP A 37 ? ? -62.85 88.12 #