data_2CRN # _entry.id 2CRN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CRN pdb_00002crn 10.2210/pdb2crn/pdb RCSB RCSB024548 ? ? WWPDB D_1000024548 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001003947.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CRN _pdbx_database_status.recvd_initial_deposition_date 2005-05-20 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Izumi, K.' 1 'Hayashi, F.' 2 'Yoshida, M.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the UBA domain of human UBASH3A protein' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Izumi, K.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yoshida, M.' 3 ? primary 'Yokoyama, S.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'UBASH3A protein' _entity.formula_weight 6420.074 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment UBA _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGSSPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDHCNDPSLDDPISGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGSSPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDHCNDPSLDDPISGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001003947.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 SER n 1 10 PRO n 1 11 SER n 1 12 LEU n 1 13 LEU n 1 14 GLU n 1 15 PRO n 1 16 LEU n 1 17 LEU n 1 18 ALA n 1 19 MET n 1 20 GLY n 1 21 PHE n 1 22 PRO n 1 23 VAL n 1 24 HIS n 1 25 THR n 1 26 ALA n 1 27 LEU n 1 28 LYS n 1 29 ALA n 1 30 LEU n 1 31 ALA n 1 32 ALA n 1 33 THR n 1 34 GLY n 1 35 ARG n 1 36 LYS n 1 37 THR n 1 38 ALA n 1 39 GLU n 1 40 GLU n 1 41 ALA n 1 42 LEU n 1 43 ALA n 1 44 TRP n 1 45 LEU n 1 46 HIS n 1 47 ASP n 1 48 HIS n 1 49 CYS n 1 50 ASN n 1 51 ASP n 1 52 PRO n 1 53 SER n 1 54 LEU n 1 55 ASP n 1 56 ASP n 1 57 PRO n 1 58 ILE n 1 59 SER n 1 60 GLY n 1 61 PRO n 1 62 SER n 1 63 SER n 1 64 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene UBASH3A _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name p040531-06 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UAS3_HUMAN _struct_ref.pdbx_db_accession P57075 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SSPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDHCNDPSLDDPI _struct_ref.pdbx_align_begin 20 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CRN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 58 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P57075 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 58 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CRN GLY A 1 ? UNP P57075 ? ? 'cloning artifact' 1 1 1 2CRN SER A 2 ? UNP P57075 ? ? 'cloning artifact' 2 2 1 2CRN SER A 3 ? UNP P57075 ? ? 'cloning artifact' 3 3 1 2CRN GLY A 4 ? UNP P57075 ? ? 'cloning artifact' 4 4 1 2CRN SER A 5 ? UNP P57075 ? ? 'cloning artifact' 5 5 1 2CRN SER A 6 ? UNP P57075 ? ? 'cloning artifact' 6 6 1 2CRN GLY A 7 ? UNP P57075 ? ? 'cloning artifact' 7 7 1 2CRN SER A 59 ? UNP P57075 ? ? 'cloning artifact' 59 8 1 2CRN GLY A 60 ? UNP P57075 ? ? 'cloning artifact' 60 9 1 2CRN PRO A 61 ? UNP P57075 ? ? 'cloning artifact' 61 10 1 2CRN SER A 62 ? UNP P57075 ? ? 'cloning artifact' 62 11 1 2CRN SER A 63 ? UNP P57075 ? ? 'cloning artifact' 63 12 1 2CRN GLY A 64 ? UNP P57075 ? ? 'cloning artifact' 64 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.03mM 13C, 15N-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model ECA _pdbx_nmr_spectrometer.manufacturer JEOL _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_ensemble.entry_id 2CRN _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CRN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection 'Delta NMR' 4.3 JEOL 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.9296 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # _exptl.entry_id 2CRN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CRN _struct.title 'Solution structure of the UBA domain of human UBASH3A protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CRN _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text ;compact three-helix bundle, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, IMMUNE SYSTEM ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 12 ? MET A 19 ? LEU A 12 MET A 19 1 ? 8 HELX_P HELX_P2 2 PRO A 22 ? GLY A 34 ? PRO A 22 GLY A 34 1 ? 13 HELX_P HELX_P3 3 THR A 37 ? CYS A 49 ? THR A 37 CYS A 49 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2CRN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CRN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLY 64 64 64 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-20 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -82.83 42.02 2 1 SER A 11 ? ? -123.11 -70.76 3 1 PRO A 22 ? ? -69.77 -163.76 4 1 CYS A 49 ? ? -35.70 -31.28 5 1 ILE A 58 ? ? -64.78 86.71 6 2 PRO A 10 ? ? -69.71 2.76 7 2 PRO A 22 ? ? -69.75 -163.76 8 2 ARG A 35 ? ? 37.13 41.57 9 2 CYS A 49 ? ? -45.94 155.05 10 2 ASN A 50 ? ? 74.17 41.42 11 3 PRO A 22 ? ? -69.75 -163.76 12 3 ARG A 35 ? ? 35.94 41.51 13 3 CYS A 49 ? ? -39.80 -29.78 14 3 PRO A 61 ? ? -69.81 2.69 15 3 SER A 63 ? ? -35.68 139.73 16 4 PRO A 10 ? ? -69.73 0.13 17 4 PRO A 22 ? ? -69.78 -163.79 18 4 ARG A 35 ? ? 39.27 37.30 19 4 ASN A 50 ? ? -82.82 44.60 20 4 SER A 59 ? ? 41.79 25.18 21 5 PRO A 10 ? ? -69.73 2.36 22 5 SER A 11 ? ? -51.13 -74.82 23 5 PRO A 22 ? ? -69.76 -163.81 24 5 ARG A 35 ? ? 35.81 44.50 25 5 CYS A 49 ? ? -34.84 -38.11 26 5 ASP A 51 ? ? -39.70 147.31 27 5 PRO A 61 ? ? -69.75 97.22 28 6 SER A 6 ? ? -36.58 139.16 29 6 PRO A 22 ? ? -69.79 -163.80 30 6 THR A 33 ? ? -96.78 53.46 31 6 ARG A 35 ? ? 34.51 46.70 32 6 HIS A 48 ? ? -109.64 43.00 33 6 ILE A 58 ? ? -59.53 106.87 34 6 SER A 63 ? ? -174.41 141.88 35 7 PRO A 10 ? ? -69.74 2.77 36 7 PRO A 22 ? ? -69.74 -163.74 37 7 HIS A 48 ? ? -103.40 43.62 38 7 ASN A 50 ? ? -84.01 37.83 39 7 LEU A 54 ? ? -97.87 44.69 40 7 SER A 59 ? ? -43.11 162.19 41 7 PRO A 61 ? ? -69.82 2.85 42 8 PRO A 22 ? ? -69.77 -163.75 43 8 THR A 33 ? ? -56.01 -71.26 44 8 ARG A 35 ? ? 39.22 30.49 45 8 HIS A 48 ? ? -103.83 43.08 46 8 ASP A 51 ? ? -39.73 144.15 47 8 ILE A 58 ? ? -38.40 123.99 48 9 PRO A 10 ? ? -69.75 99.73 49 9 SER A 11 ? ? -127.05 -55.38 50 9 PRO A 22 ? ? -69.75 -163.74 51 9 ARG A 35 ? ? 39.75 35.88 52 10 PRO A 10 ? ? -69.72 0.42 53 10 PRO A 22 ? ? -69.78 -163.71 54 10 ARG A 35 ? ? 38.40 39.88 55 10 ILE A 58 ? ? -66.82 87.44 56 11 SER A 2 ? ? 36.98 41.90 57 11 SER A 5 ? ? -130.85 -46.29 58 11 PRO A 10 ? ? -69.78 82.24 59 11 PRO A 22 ? ? -69.75 -163.75 60 11 ARG A 35 ? ? 38.55 45.37 61 11 CYS A 49 ? ? -34.39 -38.56 62 11 SER A 63 ? ? -60.21 93.41 63 12 PRO A 10 ? ? -69.82 2.94 64 12 PRO A 22 ? ? -69.71 -163.82 65 12 LEU A 54 ? ? -107.52 45.83 66 12 ILE A 58 ? ? -38.21 95.50 67 12 SER A 59 ? ? -51.20 103.09 68 13 SER A 3 ? ? -51.97 175.46 69 13 SER A 5 ? ? -35.30 -39.16 70 13 SER A 8 ? ? -37.07 140.84 71 13 PRO A 22 ? ? -69.79 -163.70 72 13 ARG A 35 ? ? 36.17 44.06 73 13 LEU A 54 ? ? -105.02 41.32 74 14 PRO A 10 ? ? -69.80 2.54 75 14 PRO A 22 ? ? -69.70 -163.81 76 14 ARG A 35 ? ? 34.80 48.70 77 14 SER A 62 ? ? -99.84 33.75 78 15 PRO A 10 ? ? -69.73 2.59 79 15 PRO A 22 ? ? -69.75 -163.81 80 15 LYS A 36 ? ? -78.40 -72.50 81 15 SER A 63 ? ? -129.32 -55.89 82 16 PRO A 10 ? ? -69.81 96.23 83 16 SER A 11 ? ? -123.79 -65.33 84 16 PRO A 22 ? ? -69.80 -163.77 85 16 ARG A 35 ? ? 35.10 54.89 86 17 SER A 5 ? ? -85.58 42.96 87 17 PRO A 10 ? ? -69.77 0.45 88 17 PRO A 22 ? ? -69.83 -163.80 89 17 ARG A 35 ? ? 36.02 42.16 90 17 CYS A 49 ? ? -34.39 -38.52 91 17 SER A 53 ? ? -110.01 76.23 92 17 ILE A 58 ? ? -50.54 97.72 93 17 PRO A 61 ? ? -69.72 -176.16 94 18 SER A 5 ? ? -51.10 170.82 95 18 PRO A 10 ? ? -69.76 1.95 96 18 PRO A 22 ? ? -69.72 -163.76 97 18 ARG A 35 ? ? 36.70 38.59 98 19 SER A 11 ? ? -129.85 -55.83 99 19 PRO A 22 ? ? -69.81 -163.65 100 19 ARG A 35 ? ? 34.77 45.09 101 19 CYS A 49 ? ? -38.21 -38.22 102 19 LEU A 54 ? ? -113.30 78.52 103 19 SER A 59 ? ? -38.41 106.68 104 19 PRO A 61 ? ? -69.79 92.00 105 20 PRO A 10 ? ? -69.78 97.38 106 20 SER A 11 ? ? -124.03 -61.25 107 20 PRO A 22 ? ? -69.72 -163.73 108 20 ALA A 32 ? ? -75.71 -72.32 109 20 ARG A 35 ? ? 49.37 26.78 110 20 CYS A 49 ? ? -35.07 -35.82 #