data_2CSV # _entry.id 2CSV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CSV pdb_00002csv 10.2210/pdb2csv/pdb RCSB RCSB024584 ? ? WWPDB D_1000024584 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001001220.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CSV _pdbx_database_status.recvd_initial_deposition_date 2005-05-23 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Inoue, K.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the zf-B_box type2 domain of human tripartite motif protein TRIM29 isoform alpha' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Inoue, K.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tripartite motif protein 29' 7920.833 1 ? ? 'zf-B_box domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ataxia-telangiectasia group D-associated protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGQLLEPIRDFEARKCPVHGKTMELFCQTDQTCICYLCMFQEHKNHSTVTVEEAKAEKETESGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGQLLEPIRDFEARKCPVHGKTMELFCQTDQTCICYLCMFQEHKNHSTVTVEEAKAEKETESGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001001220.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLN n 1 9 LEU n 1 10 LEU n 1 11 GLU n 1 12 PRO n 1 13 ILE n 1 14 ARG n 1 15 ASP n 1 16 PHE n 1 17 GLU n 1 18 ALA n 1 19 ARG n 1 20 LYS n 1 21 CYS n 1 22 PRO n 1 23 VAL n 1 24 HIS n 1 25 GLY n 1 26 LYS n 1 27 THR n 1 28 MET n 1 29 GLU n 1 30 LEU n 1 31 PHE n 1 32 CYS n 1 33 GLN n 1 34 THR n 1 35 ASP n 1 36 GLN n 1 37 THR n 1 38 CYS n 1 39 ILE n 1 40 CYS n 1 41 TYR n 1 42 LEU n 1 43 CYS n 1 44 MET n 1 45 PHE n 1 46 GLN n 1 47 GLU n 1 48 HIS n 1 49 LYS n 1 50 ASN n 1 51 HIS n 1 52 SER n 1 53 THR n 1 54 VAL n 1 55 THR n 1 56 VAL n 1 57 GLU n 1 58 GLU n 1 59 ALA n 1 60 LYS n 1 61 ALA n 1 62 GLU n 1 63 LYS n 1 64 GLU n 1 65 THR n 1 66 GLU n 1 67 SER n 1 68 GLY n 1 69 PRO n 1 70 SER n 1 71 SER n 1 72 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'TRIM29, ATDC' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040906-08 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRI29_HUMAN _struct_ref.pdbx_db_accession Q14134 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QLLEPIRDFEARKCPVHGKTMELFCQTDQTCICYLCMFQEHKNHSTVTVEEAKAEKETE _struct_ref.pdbx_align_begin 212 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CSV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14134 _struct_ref_seq.db_align_beg 212 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 270 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CSV GLY A 1 ? UNP Q14134 ? ? 'cloning artifact' 1 1 1 2CSV SER A 2 ? UNP Q14134 ? ? 'cloning artifact' 2 2 1 2CSV SER A 3 ? UNP Q14134 ? ? 'cloning artifact' 3 3 1 2CSV GLY A 4 ? UNP Q14134 ? ? 'cloning artifact' 4 4 1 2CSV SER A 5 ? UNP Q14134 ? ? 'cloning artifact' 5 5 1 2CSV SER A 6 ? UNP Q14134 ? ? 'cloning artifact' 6 6 1 2CSV GLY A 7 ? UNP Q14134 ? ? 'cloning artifact' 7 7 1 2CSV SER A 67 ? UNP Q14134 ? ? 'cloning artifact' 67 8 1 2CSV GLY A 68 ? UNP Q14134 ? ? 'cloning artifact' 68 9 1 2CSV PRO A 69 ? UNP Q14134 ? ? 'cloning artifact' 69 10 1 2CSV SER A 70 ? UNP Q14134 ? ? 'cloning artifact' 70 11 1 2CSV SER A 71 ? UNP Q14134 ? ? 'cloning artifact' 71 12 1 2CSV GLY A 72 ? UNP Q14134 ? ? 'cloning artifact' 72 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.12mM U-15N,13C-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.01mM ZnCl2; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CSV _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CSV _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CSV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9296 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2CSV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CSV _struct.title 'Solution structure of the zf-B_box type2 domain of human tripartite motif protein TRIM29 isoform alpha' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CSV _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;zf-B_box domain, Tripartite motif protein 29, TRIM29, Ataxia-telangiectasia group D-associated protein, ATDC, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 40 ? GLN A 46 ? CYS A 40 GLN A 46 1 ? 7 HELX_P HELX_P2 2 VAL A 56 ? GLU A 64 ? VAL A 56 GLU A 64 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 200 1_555 ? ? ? ? ? ? ? 2.312 ? ? metalc2 metalc ? ? A HIS 24 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 24 A ZN 200 1_555 ? ? ? ? ? ? ? 2.022 ? ? metalc3 metalc ? ? A CYS 32 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 32 A ZN 400 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc4 metalc ? ? A ASP 35 OD1 ? ? ? 1_555 C ZN . ZN ? ? A ASP 35 A ZN 400 1_555 ? ? ? ? ? ? ? 2.975 ? ? metalc5 metalc ? ? A ASP 35 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 35 A ZN 400 1_555 ? ? ? ? ? ? ? 2.349 ? ? metalc6 metalc ? ? A CYS 40 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 40 A ZN 200 1_555 ? ? ? ? ? ? ? 2.349 ? ? metalc7 metalc ? ? A CYS 43 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 43 A ZN 200 1_555 ? ? ? ? ? ? ? 2.253 ? ? metalc8 metalc ? ? A HIS 48 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 48 A ZN 400 1_555 ? ? ? ? ? ? ? 2.050 ? ? metalc9 metalc ? ? A HIS 51 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 51 A ZN 400 1_555 ? ? ? ? ? ? ? 2.050 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 38 ? ILE A 39 ? CYS A 38 ILE A 39 A 2 LEU A 30 ? CYS A 32 ? LEU A 30 CYS A 32 A 3 THR A 53 ? THR A 55 ? THR A 53 THR A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 39 ? O ILE A 39 N LEU A 30 ? N LEU A 30 A 2 3 N PHE A 31 ? N PHE A 31 O VAL A 54 ? O VAL A 54 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 200 ? 4 'BINDING SITE FOR RESIDUE ZN A 200' AC2 Software A ZN 400 ? 4 'BINDING SITE FOR RESIDUE ZN A 400' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 2 AC1 4 HIS A 24 ? HIS A 24 . ? 1_555 ? 3 AC1 4 CYS A 40 ? CYS A 40 . ? 1_555 ? 4 AC1 4 CYS A 43 ? CYS A 43 . ? 1_555 ? 5 AC2 4 CYS A 32 ? CYS A 32 . ? 1_555 ? 6 AC2 4 ASP A 35 ? ASP A 35 . ? 1_555 ? 7 AC2 4 HIS A 48 ? HIS A 48 . ? 1_555 ? 8 AC2 4 HIS A 51 ? HIS A 51 . ? 1_555 ? # _database_PDB_matrix.entry_id 2CSV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CSV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 200 200 ZN ZN A . C 2 ZN 1 400 400 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 ND1 ? A HIS 24 ? A HIS 24 ? 1_555 111.5 ? 2 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 111.5 ? 3 ND1 ? A HIS 24 ? A HIS 24 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 106.1 ? 4 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 106.1 ? 5 ND1 ? A HIS 24 ? A HIS 24 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 115.6 ? 6 SG ? A CYS 40 ? A CYS 40 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 106.0 ? 7 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 OD1 ? A ASP 35 ? A ASP 35 ? 1_555 67.6 ? 8 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 OD2 ? A ASP 35 ? A ASP 35 ? 1_555 110.1 ? 9 OD1 ? A ASP 35 ? A ASP 35 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 OD2 ? A ASP 35 ? A ASP 35 ? 1_555 47.0 ? 10 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 ND1 ? A HIS 48 ? A HIS 48 ? 1_555 105.2 ? 11 OD1 ? A ASP 35 ? A ASP 35 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 ND1 ? A HIS 48 ? A HIS 48 ? 1_555 97.9 ? 12 OD2 ? A ASP 35 ? A ASP 35 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 ND1 ? A HIS 48 ? A HIS 48 ? 1_555 105.2 ? 13 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 ND1 ? A HIS 51 ? A HIS 51 ? 1_555 112.9 ? 14 OD1 ? A ASP 35 ? A ASP 35 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 ND1 ? A HIS 51 ? A HIS 51 ? 1_555 141.9 ? 15 OD2 ? A ASP 35 ? A ASP 35 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 ND1 ? A HIS 51 ? A HIS 51 ? 1_555 105.9 ? 16 ND1 ? A HIS 48 ? A HIS 48 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 ND1 ? A HIS 51 ? A HIS 51 ? 1_555 117.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-23 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_ref_seq_dif.details' 29 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -45.70 152.60 2 1 GLN A 8 ? ? 39.69 41.76 3 1 PRO A 12 ? ? -69.77 -172.67 4 1 GLN A 46 ? ? -116.32 -75.00 5 1 HIS A 48 ? ? -110.38 78.56 6 1 HIS A 51 ? ? -43.51 161.28 7 1 ALA A 61 ? ? -34.37 -35.97 8 1 THR A 65 ? ? -37.00 144.33 9 1 GLU A 66 ? ? -40.50 160.13 10 2 SER A 6 ? ? -127.31 -58.50 11 2 GLN A 8 ? ? -108.70 44.68 12 2 GLU A 17 ? ? -37.54 105.17 13 2 THR A 27 ? ? -53.66 95.22 14 2 GLN A 46 ? ? -116.17 -75.02 15 2 HIS A 48 ? ? -112.42 76.22 16 2 HIS A 51 ? ? -65.42 -176.74 17 3 LEU A 10 ? ? -39.03 126.39 18 3 PRO A 12 ? ? -69.74 -171.30 19 3 THR A 27 ? ? -52.54 98.08 20 3 GLN A 46 ? ? -116.91 -75.08 21 3 HIS A 48 ? ? -115.35 76.54 22 3 HIS A 51 ? ? -61.05 -175.18 23 4 SER A 2 ? ? 39.92 42.38 24 4 PRO A 12 ? ? -69.75 -175.00 25 4 ASP A 15 ? ? -81.84 45.98 26 4 ALA A 18 ? ? -87.80 34.05 27 4 GLN A 46 ? ? -111.81 -74.85 28 4 GLU A 47 ? ? -38.94 -71.76 29 4 HIS A 48 ? ? -110.53 79.54 30 4 HIS A 51 ? ? -59.66 -178.34 31 4 THR A 65 ? ? -36.14 134.98 32 5 PRO A 12 ? ? -69.76 -169.45 33 5 GLU A 17 ? ? -34.55 101.92 34 5 THR A 27 ? ? -53.06 97.01 35 5 GLN A 46 ? ? -114.50 -75.14 36 5 HIS A 48 ? ? -105.66 72.75 37 5 ASN A 50 ? ? -122.52 -60.34 38 5 HIS A 51 ? ? -47.38 165.82 39 5 GLU A 62 ? ? -62.62 -70.53 40 5 GLU A 64 ? ? -34.53 130.43 41 5 SER A 70 ? ? -87.76 42.17 42 6 PRO A 12 ? ? -69.76 -176.65 43 6 PHE A 16 ? ? -105.41 -68.31 44 6 THR A 27 ? ? -48.95 101.04 45 6 GLN A 46 ? ? -107.90 -75.18 46 6 GLU A 47 ? ? -39.66 -72.92 47 6 HIS A 48 ? ? -101.83 77.58 48 6 HIS A 51 ? ? -40.40 158.50 49 6 GLU A 64 ? ? -44.99 165.53 50 6 SER A 67 ? ? -46.77 170.64 51 6 PRO A 69 ? ? -69.78 3.28 52 6 SER A 70 ? ? -34.60 115.03 53 7 SER A 5 ? ? -83.96 42.19 54 7 SER A 6 ? ? -68.78 89.85 55 7 THR A 27 ? ? -50.48 100.02 56 7 GLN A 46 ? ? -119.95 -75.41 57 7 HIS A 48 ? ? -113.41 77.90 58 7 HIS A 51 ? ? -64.80 -174.95 59 7 THR A 65 ? ? 34.21 40.76 60 7 GLU A 66 ? ? -43.64 156.16 61 7 SER A 71 ? ? -35.65 150.37 62 8 THR A 27 ? ? -55.38 93.24 63 8 MET A 28 ? ? -45.88 107.16 64 8 MET A 44 ? ? -49.65 -18.40 65 8 GLN A 46 ? ? -117.72 -74.66 66 8 HIS A 48 ? ? -111.53 77.23 67 8 ASN A 50 ? ? -97.18 35.68 68 8 GLU A 66 ? ? -115.96 73.68 69 9 PRO A 12 ? ? -69.77 -176.57 70 9 GLU A 17 ? ? 36.85 46.46 71 9 ALA A 18 ? ? -59.90 -9.80 72 9 THR A 27 ? ? -52.85 94.76 73 9 MET A 28 ? ? -53.53 109.28 74 9 GLN A 46 ? ? -121.61 -74.76 75 9 GLU A 47 ? ? -45.32 -70.78 76 9 HIS A 51 ? ? -47.43 167.15 77 10 ARG A 14 ? ? -130.71 -45.22 78 10 THR A 27 ? ? -42.19 98.90 79 10 GLN A 46 ? ? -114.03 -75.11 80 10 HIS A 48 ? ? -115.27 79.89 81 10 THR A 65 ? ? -38.61 103.11 82 10 PRO A 69 ? ? -69.75 97.52 83 11 SER A 6 ? ? 38.90 40.77 84 11 PRO A 12 ? ? -69.76 -176.20 85 11 ASP A 15 ? ? -78.51 47.77 86 11 PHE A 16 ? ? -133.96 -59.08 87 11 ALA A 18 ? ? -94.84 36.89 88 11 MET A 44 ? ? -48.26 -19.77 89 11 GLN A 46 ? ? -115.79 -75.33 90 11 HIS A 48 ? ? -112.43 77.34 91 11 ASN A 50 ? ? -98.70 37.97 92 11 SER A 52 ? ? -104.61 78.38 93 11 GLU A 64 ? ? -37.70 115.42 94 12 PRO A 12 ? ? -69.76 -175.25 95 12 THR A 27 ? ? -51.10 95.04 96 12 MET A 28 ? ? -47.42 109.65 97 12 MET A 44 ? ? -48.84 -19.96 98 12 GLN A 46 ? ? -117.77 -75.20 99 12 SER A 70 ? ? -99.82 46.02 100 13 GLU A 17 ? ? -46.26 98.37 101 13 THR A 27 ? ? -52.00 95.97 102 13 MET A 28 ? ? -48.44 103.86 103 13 GLN A 46 ? ? -118.71 -74.97 104 13 GLU A 47 ? ? -43.55 -71.85 105 13 HIS A 48 ? ? -101.56 77.20 106 13 HIS A 51 ? ? -41.72 158.42 107 13 GLU A 66 ? ? -58.68 100.99 108 14 SER A 2 ? ? 37.46 44.07 109 14 PRO A 12 ? ? -69.77 -171.94 110 14 ASP A 15 ? ? -83.83 35.84 111 14 THR A 27 ? ? -51.14 95.56 112 14 GLN A 46 ? ? -129.12 -75.12 113 14 HIS A 48 ? ? -116.87 72.95 114 14 HIS A 51 ? ? -48.83 176.21 115 15 GLN A 8 ? ? -111.66 52.16 116 15 GLU A 17 ? ? 34.45 41.92 117 15 ARG A 19 ? ? -37.16 116.79 118 15 THR A 27 ? ? -48.20 102.13 119 15 GLN A 46 ? ? -123.45 -75.23 120 15 HIS A 51 ? ? -56.19 179.75 121 16 SER A 2 ? ? 35.38 45.01 122 16 GLN A 8 ? ? -35.15 124.47 123 16 LEU A 10 ? ? -52.05 177.08 124 16 PRO A 12 ? ? -69.78 -174.81 125 16 GLU A 17 ? ? 39.85 51.57 126 16 THR A 27 ? ? -45.96 98.93 127 16 GLN A 46 ? ? -114.84 -75.65 128 16 HIS A 48 ? ? -108.43 74.50 129 16 HIS A 51 ? ? -38.19 146.59 130 16 GLU A 62 ? ? -79.79 -73.46 131 17 PRO A 12 ? ? -69.72 -176.68 132 17 ARG A 14 ? ? -122.98 -52.06 133 17 ASP A 15 ? ? -85.76 34.54 134 17 PHE A 16 ? ? -79.01 -71.51 135 17 THR A 27 ? ? -51.92 98.03 136 17 MET A 28 ? ? -54.24 96.29 137 17 GLN A 46 ? ? -107.13 -74.89 138 17 HIS A 48 ? ? -113.43 78.40 139 17 ASN A 50 ? ? -96.15 34.69 140 17 THR A 65 ? ? -57.46 94.67 141 17 PRO A 69 ? ? -69.77 0.44 142 17 SER A 70 ? ? -55.81 89.94 143 17 SER A 71 ? ? -37.82 154.85 144 18 SER A 2 ? ? -170.07 141.71 145 18 SER A 6 ? ? -170.30 109.14 146 18 GLN A 8 ? ? -90.73 51.03 147 18 LEU A 10 ? ? -45.83 167.62 148 18 PRO A 12 ? ? -69.82 -177.48 149 18 GLU A 17 ? ? -42.86 103.16 150 18 ARG A 19 ? ? -34.79 100.14 151 18 THR A 27 ? ? -52.45 103.09 152 18 GLN A 46 ? ? -116.54 -75.04 153 18 HIS A 48 ? ? -112.27 78.66 154 18 HIS A 51 ? ? -40.88 158.20 155 19 ASP A 15 ? ? -174.91 111.73 156 19 ARG A 19 ? ? -34.30 98.19 157 19 THR A 27 ? ? -56.81 98.54 158 19 GLN A 46 ? ? -121.67 -75.60 159 19 GLU A 47 ? ? -42.28 -71.32 160 19 HIS A 48 ? ? -103.29 75.48 161 19 ALA A 61 ? ? -39.09 -36.02 162 19 GLU A 66 ? ? -83.90 42.28 163 20 PHE A 16 ? ? -113.20 -70.58 164 20 THR A 27 ? ? -53.66 94.53 165 20 MET A 28 ? ? -45.10 109.44 166 20 GLN A 46 ? ? -134.37 -69.75 167 20 HIS A 48 ? ? -118.00 76.10 168 20 HIS A 51 ? ? -34.09 140.24 169 20 GLU A 64 ? ? -34.47 126.86 170 20 PRO A 69 ? ? -69.77 5.36 171 20 SER A 70 ? ? -30.14 116.38 172 20 SER A 71 ? ? -106.35 54.54 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #