data_2CTC # _entry.id 2CTC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2CTC WWPDB D_1000177956 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CTC _pdbx_database_status.recvd_initial_deposition_date 1993-04-02 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Teplyakov, A.' 1 'Wilson, K.S.' 2 'Orioli, P.' 3 'Mangani, S.' 4 # _citation.id primary _citation.title 'High-resolution structure of the complex between carboxypeptidase A and L-phenyl lactate.' _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_volume 49 _citation.page_first 534 _citation.page_last 540 _citation.year 1993 _citation.journal_id_ASTM ABCRE6 _citation.country DK _citation.journal_id_ISSN 0907-4449 _citation.journal_id_CSD 0766 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15299490 _citation.pdbx_database_id_DOI 10.1107/S0907444993007267 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Teplyakov, A.' 1 primary 'Wilson, K.S.' 2 primary 'Orioli, P.' 3 primary 'Mangani, S.' 4 # _cell.entry_id 2CTC _cell.length_a 51.600 _cell.length_b 60.270 _cell.length_c 47.250 _cell.angle_alpha 90.00 _cell.angle_beta 97.27 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2CTC _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CARBOXYPEPTIDASE A' 34517.480 1 3.4.17.1 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'ALPHA-HYDROXY-BETA-PHENYL-PROPIONIC ACID' 166.174 1 ? ? ? ? 4 water nat water 18.015 181 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ARSTNTFNYATYHTLDEIYDFMDLLVAEHPQLVSKLQIGRSYEGRPIYVLKFSTGGSNRPAIWIDLGIHSREWITQATGV WFAKKFTEDYGQDPSFTAILDSMDIFLEIVTNPDGFAFTHSQNRLWRKTRSVTSSSLCVGVDANRNWDAGFGKAGASSSP CSETYHGKYANSEVEVKSIVDFVKDHGNFKAFLSIHSYSQLLLYPYGYTTQSIPDKTELNQVAKSAVEALKSLYGTSYKY GSIITTIYQASGGSIDWSYNQGIKYSFTFELRDTGRYGFLLPASQIIPTAQETWLGVLTIMEHTLNN ; _entity_poly.pdbx_seq_one_letter_code_can ;ARSTNTFNYATYHTLDEIYDFMDLLVAEHPQLVSKLQIGRSYEGRPIYVLKFSTGGSNRPAIWIDLGIHSREWITQATGV WFAKKFTEDYGQDPSFTAILDSMDIFLEIVTNPDGFAFTHSQNRLWRKTRSVTSSSLCVGVDANRNWDAGFGKAGASSSP CSETYHGKYANSEVEVKSIVDFVKDHGNFKAFLSIHSYSQLLLYPYGYTTQSIPDKTELNQVAKSAVEALKSLYGTSYKY GSIITTIYQASGGSIDWSYNQGIKYSFTFELRDTGRYGFLLPASQIIPTAQETWLGVLTIMEHTLNN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ARG n 1 3 SER n 1 4 THR n 1 5 ASN n 1 6 THR n 1 7 PHE n 1 8 ASN n 1 9 TYR n 1 10 ALA n 1 11 THR n 1 12 TYR n 1 13 HIS n 1 14 THR n 1 15 LEU n 1 16 ASP n 1 17 GLU n 1 18 ILE n 1 19 TYR n 1 20 ASP n 1 21 PHE n 1 22 MET n 1 23 ASP n 1 24 LEU n 1 25 LEU n 1 26 VAL n 1 27 ALA n 1 28 GLU n 1 29 HIS n 1 30 PRO n 1 31 GLN n 1 32 LEU n 1 33 VAL n 1 34 SER n 1 35 LYS n 1 36 LEU n 1 37 GLN n 1 38 ILE n 1 39 GLY n 1 40 ARG n 1 41 SER n 1 42 TYR n 1 43 GLU n 1 44 GLY n 1 45 ARG n 1 46 PRO n 1 47 ILE n 1 48 TYR n 1 49 VAL n 1 50 LEU n 1 51 LYS n 1 52 PHE n 1 53 SER n 1 54 THR n 1 55 GLY n 1 56 GLY n 1 57 SER n 1 58 ASN n 1 59 ARG n 1 60 PRO n 1 61 ALA n 1 62 ILE n 1 63 TRP n 1 64 ILE n 1 65 ASP n 1 66 LEU n 1 67 GLY n 1 68 ILE n 1 69 HIS n 1 70 SER n 1 71 ARG n 1 72 GLU n 1 73 TRP n 1 74 ILE n 1 75 THR n 1 76 GLN n 1 77 ALA n 1 78 THR n 1 79 GLY n 1 80 VAL n 1 81 TRP n 1 82 PHE n 1 83 ALA n 1 84 LYS n 1 85 LYS n 1 86 PHE n 1 87 THR n 1 88 GLU n 1 89 ASP n 1 90 TYR n 1 91 GLY n 1 92 GLN n 1 93 ASP n 1 94 PRO n 1 95 SER n 1 96 PHE n 1 97 THR n 1 98 ALA n 1 99 ILE n 1 100 LEU n 1 101 ASP n 1 102 SER n 1 103 MET n 1 104 ASP n 1 105 ILE n 1 106 PHE n 1 107 LEU n 1 108 GLU n 1 109 ILE n 1 110 VAL n 1 111 THR n 1 112 ASN n 1 113 PRO n 1 114 ASP n 1 115 GLY n 1 116 PHE n 1 117 ALA n 1 118 PHE n 1 119 THR n 1 120 HIS n 1 121 SER n 1 122 GLN n 1 123 ASN n 1 124 ARG n 1 125 LEU n 1 126 TRP n 1 127 ARG n 1 128 LYS n 1 129 THR n 1 130 ARG n 1 131 SER n 1 132 VAL n 1 133 THR n 1 134 SER n 1 135 SER n 1 136 SER n 1 137 LEU n 1 138 CYS n 1 139 VAL n 1 140 GLY n 1 141 VAL n 1 142 ASP n 1 143 ALA n 1 144 ASN n 1 145 ARG n 1 146 ASN n 1 147 TRP n 1 148 ASP n 1 149 ALA n 1 150 GLY n 1 151 PHE n 1 152 GLY n 1 153 LYS n 1 154 ALA n 1 155 GLY n 1 156 ALA n 1 157 SER n 1 158 SER n 1 159 SER n 1 160 PRO n 1 161 CYS n 1 162 SER n 1 163 GLU n 1 164 THR n 1 165 TYR n 1 166 HIS n 1 167 GLY n 1 168 LYS n 1 169 TYR n 1 170 ALA n 1 171 ASN n 1 172 SER n 1 173 GLU n 1 174 VAL n 1 175 GLU n 1 176 VAL n 1 177 LYS n 1 178 SER n 1 179 ILE n 1 180 VAL n 1 181 ASP n 1 182 PHE n 1 183 VAL n 1 184 LYS n 1 185 ASP n 1 186 HIS n 1 187 GLY n 1 188 ASN n 1 189 PHE n 1 190 LYS n 1 191 ALA n 1 192 PHE n 1 193 LEU n 1 194 SER n 1 195 ILE n 1 196 HIS n 1 197 SER n 1 198 TYR n 1 199 SER n 1 200 GLN n 1 201 LEU n 1 202 LEU n 1 203 LEU n 1 204 TYR n 1 205 PRO n 1 206 TYR n 1 207 GLY n 1 208 TYR n 1 209 THR n 1 210 THR n 1 211 GLN n 1 212 SER n 1 213 ILE n 1 214 PRO n 1 215 ASP n 1 216 LYS n 1 217 THR n 1 218 GLU n 1 219 LEU n 1 220 ASN n 1 221 GLN n 1 222 VAL n 1 223 ALA n 1 224 LYS n 1 225 SER n 1 226 ALA n 1 227 VAL n 1 228 GLU n 1 229 ALA n 1 230 LEU n 1 231 LYS n 1 232 SER n 1 233 LEU n 1 234 TYR n 1 235 GLY n 1 236 THR n 1 237 SER n 1 238 TYR n 1 239 LYS n 1 240 TYR n 1 241 GLY n 1 242 SER n 1 243 ILE n 1 244 ILE n 1 245 THR n 1 246 THR n 1 247 ILE n 1 248 TYR n 1 249 GLN n 1 250 ALA n 1 251 SER n 1 252 GLY n 1 253 GLY n 1 254 SER n 1 255 ILE n 1 256 ASP n 1 257 TRP n 1 258 SER n 1 259 TYR n 1 260 ASN n 1 261 GLN n 1 262 GLY n 1 263 ILE n 1 264 LYS n 1 265 TYR n 1 266 SER n 1 267 PHE n 1 268 THR n 1 269 PHE n 1 270 GLU n 1 271 LEU n 1 272 ARG n 1 273 ASP n 1 274 THR n 1 275 GLY n 1 276 ARG n 1 277 TYR n 1 278 GLY n 1 279 PHE n 1 280 LEU n 1 281 LEU n 1 282 PRO n 1 283 ALA n 1 284 SER n 1 285 GLN n 1 286 ILE n 1 287 ILE n 1 288 PRO n 1 289 THR n 1 290 ALA n 1 291 GLN n 1 292 GLU n 1 293 THR n 1 294 TRP n 1 295 LEU n 1 296 GLY n 1 297 VAL n 1 298 LEU n 1 299 THR n 1 300 ILE n 1 301 MET n 1 302 GLU n 1 303 HIS n 1 304 THR n 1 305 LEU n 1 306 ASN n 1 307 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ PANCREAS _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CBPA1_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00730 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MQGLLILSVLLGAALGKEDFVGHQVLRITAADEAEVQTVKELEDLEHLQLDFWRGPGQPGSPIDVRVPFPSLQAVKVFLE AHGIRYRIMIEDVQSLLDEEQEQMFASQSRARSTNTFNYATYHTLDEIYDFMDLLVAEHPQLVSKLQIGRSYEGRPIYVL KFSTGGSNRPAIWIDLGIHSREWITQATGVWFAKKFTEDYGQDPSFTAILDSMDIFLEIVTNPDGFAFTHSQNRLWRKTR SVTSSSLCVGVDANRNWDAGFGKAGASSSPCSETYHGKYANSEVEVKSIVDFVKDHGNFKAFLSIHSYSQLLLYPYGYTT QSIPDKTELNQVAKSAVEALKSLYGTSYKYGSIITTIYQASGGSIDWSYNQGIKYSFTFELRDTGRYGFLLPASQIIPTA QETWLGVLTIMEHTLNNLY ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CTC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 307 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00730 _struct_ref_seq.db_align_beg 111 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 417 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 307 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HFA 'L-peptide linking' . 'ALPHA-HYDROXY-BETA-PHENYL-PROPIONIC ACID' ? 'C9 H10 O3' 166.174 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 2CTC _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.11 _exptl_crystal.density_percent_sol 41.73 _exptl_crystal.description ? # _refine.entry_id 2CTC _refine.ls_number_reflns_obs 4582 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 1.4 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.16 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2442 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.number_atoms_solvent 181 _refine_hist.number_atoms_total 2636 _refine_hist.d_res_high 1.4 _refine_hist.d_res_low . # _struct.entry_id 2CTC _struct.title 'THE HIGH RESOLUTION CRYSTAL STRUCTURE OF THE COMPLEX BETWEEN CARBOXYPEPTIDASE A AND L-PHENYL LACTATE' _struct.pdbx_descriptor 'CARBOXYPEPTIDASE A (E.C.3.4.17.1) COMPLEX WITH L-PHENYL LACTATE (L-O-PHE)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CTC _struct_keywords.pdbx_keywords 'HYDROLASE(C-TERMINAL PEPTIDASE)' _struct_keywords.text 'HYDROLASE(C-TERMINAL PEPTIDASE)' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 LEU A 15 ? GLU A 28 ? LEU A 15 GLU A 28 1 ? 14 HELX_P HELX_P2 H2 TRP A 73 ? ASP A 89 ? TRP A 73 ASP A 89 1 ? 17 HELX_P HELX_P3 H3 PRO A 94 ? SER A 102 ? PRO A 94 SER A 102 1 ? 9 HELX_P HELX_P4 H4 PRO A 113 ? SER A 121 ? PRO A 113 SER A 121 1 ? 9 HELX_P HELX_P5 H5 VAL A 174 ? HIS A 186 ? VAL A 174 HIS A 186 1 ? 13 HELX_P HELX_P6 H6 LYS A 216 ? LYS A 231 ? LYS A 216 LYS A 231 1 ? 16 HELX_P HELX_P7 H7 ILE A 243 ? THR A 246 ? ILE A 243 THR A 246 1 ? 4 HELX_P HELX_P8 H8 SER A 254 ? ASN A 260 ? SER A 254 ASN A 260 1 ? 7 HELX_P HELX_P9 H9 ILE A 286 ? ASN A 306 ? ILE A 286 ASN A 306 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 138 SG ? ? ? 1_555 A CYS 161 SG ? ? A CYS 138 A CYS 161 1_555 ? ? ? ? ? ? ? 2.013 ? metalc1 metalc ? ? A HIS 69 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 69 A ZN 308 1_555 ? ? ? ? ? ? ? 2.075 ? metalc2 metalc ? ? A GLU 72 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 72 A ZN 308 1_555 ? ? ? ? ? ? ? 2.315 ? metalc3 metalc ? ? A GLU 72 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 72 A ZN 308 1_555 ? ? ? ? ? ? ? 2.252 ? metalc4 metalc ? ? A HIS 196 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 196 A ZN 308 1_555 ? ? ? ? ? ? ? 2.126 ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 D HOH . O ? ? A ZN 308 A HOH 338 1_555 ? ? ? ? ? ? ? 2.004 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 197 A . ? SER 197 A TYR 198 A ? TYR 198 A 1 -2.83 2 PRO 205 A . ? PRO 205 A TYR 206 A ? TYR 206 A 1 0.99 3 ARG 272 A . ? ARG 272 A ASP 273 A ? ASP 273 A 1 -3.11 # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel S1 3 4 ? parallel S1 4 5 ? parallel S1 5 6 ? parallel S1 6 7 ? anti-parallel S1 7 8 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 LEU A 32 ? LEU A 36 ? LEU A 32 LEU A 36 S1 2 VAL A 49 ? SER A 53 ? VAL A 49 SER A 53 S1 3 ASP A 104 ? GLU A 108 ? ASP A 104 GLU A 108 S1 4 PRO A 60 ? LEU A 66 ? PRO A 60 LEU A 66 S1 5 LYS A 190 ? HIS A 196 ? LYS A 190 HIS A 196 S1 6 TYR A 265 ? LEU A 271 ? TYR A 265 LEU A 271 S1 7 GLN A 200 ? TYR A 204 ? GLN A 200 TYR A 204 S1 8 LYS A 239 ? ILE A 243 ? LYS A 239 ILE A 243 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 O SER A 34 ? O SER A 34 N LYS A 51 ? N LYS A 51 S1 2 3 O LEU A 50 ? O LEU A 50 N LEU A 107 ? N LEU A 107 S1 3 4 O PHE A 106 ? O PHE A 106 N ILE A 64 ? N ILE A 64 S1 4 5 O TRP A 63 ? O TRP A 63 N LEU A 193 ? N LEU A 193 S1 5 6 O SER A 194 ? O SER A 194 N PHE A 269 ? N PHE A 269 S1 6 7 O THR A 268 ? O THR A 268 N LEU A 203 ? N LEU A 203 S1 7 8 O LEU A 202 ? O LEU A 202 N GLY A 241 ? N GLY A 241 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 308' AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE HFA A 309' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 69 ? HIS A 69 . ? 1_555 ? 2 AC1 4 GLU A 72 ? GLU A 72 . ? 1_555 ? 3 AC1 4 HIS A 196 ? HIS A 196 . ? 1_555 ? 4 AC1 4 HOH D . ? HOH A 338 . ? 1_555 ? 5 AC2 11 HIS A 69 ? HIS A 69 . ? 1_555 ? 6 AC2 11 ARG A 127 ? ARG A 127 . ? 1_555 ? 7 AC2 11 ASN A 144 ? ASN A 144 . ? 1_555 ? 8 AC2 11 ARG A 145 ? ARG A 145 . ? 1_555 ? 9 AC2 11 ILE A 243 ? ILE A 243 . ? 1_555 ? 10 AC2 11 TYR A 248 ? TYR A 248 . ? 1_555 ? 11 AC2 11 ALA A 250 ? ALA A 250 . ? 1_555 ? 12 AC2 11 THR A 268 ? THR A 268 . ? 1_555 ? 13 AC2 11 GLU A 270 ? GLU A 270 . ? 1_555 ? 14 AC2 11 HOH D . ? HOH A 338 . ? 1_555 ? 15 AC2 11 HOH D . ? HOH A 392 . ? 1_555 ? # _database_PDB_matrix.entry_id 2CTC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CTC _atom_sites.fract_transf_matrix[1][1] 0.019380 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002472 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016592 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021336 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text 'PEPTIDE BONDS BETWEEN RESIDUES SER 197 - TYR 198, PRO 205 - TYR 206, AND ARG 272 - ASP 273 ARE IN CIS CONFORMATION.' # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 TRP 63 63 63 TRP TRP A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 TRP 81 81 81 TRP TRP A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 CYS 138 138 138 CYS CYS A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 TRP 147 147 147 TRP TRP A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 SER 159 159 159 SER SER A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 CYS 161 161 161 CYS CYS A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 HIS 166 166 166 HIS HIS A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 HIS 186 186 186 HIS HIS A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 ASN 188 188 188 ASN ASN A . n A 1 189 PHE 189 189 189 PHE PHE A . n A 1 190 LYS 190 190 190 LYS LYS A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 SER 194 194 194 SER SER A . n A 1 195 ILE 195 195 195 ILE ILE A . n A 1 196 HIS 196 196 196 HIS HIS A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 TYR 198 198 198 TYR TYR A . n A 1 199 SER 199 199 199 SER SER A . n A 1 200 GLN 200 200 200 GLN GLN A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 TYR 204 204 204 TYR TYR A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 TYR 206 206 206 TYR TYR A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 TYR 208 208 208 TYR TYR A . n A 1 209 THR 209 209 209 THR THR A . n A 1 210 THR 210 210 210 THR THR A . n A 1 211 GLN 211 211 211 GLN GLN A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 ILE 213 213 213 ILE ILE A . n A 1 214 PRO 214 214 214 PRO PRO A . n A 1 215 ASP 215 215 215 ASP ASP A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 THR 217 217 217 THR THR A . n A 1 218 GLU 218 218 218 GLU GLU A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 ASN 220 220 220 ASN ASN A . n A 1 221 GLN 221 221 221 GLN GLN A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 ALA 223 223 223 ALA ALA A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 LYS 231 231 231 LYS LYS A . n A 1 232 SER 232 232 232 SER SER A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 TYR 234 234 234 TYR TYR A . n A 1 235 GLY 235 235 235 GLY GLY A . n A 1 236 THR 236 236 236 THR THR A . n A 1 237 SER 237 237 237 SER SER A . n A 1 238 TYR 238 238 238 TYR TYR A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 TYR 240 240 240 TYR TYR A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 SER 242 242 242 SER SER A . n A 1 243 ILE 243 243 243 ILE ILE A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 THR 245 245 245 THR THR A . n A 1 246 THR 246 246 246 THR THR A . n A 1 247 ILE 247 247 247 ILE ILE A . n A 1 248 TYR 248 248 248 TYR TYR A . n A 1 249 GLN 249 249 249 GLN GLN A . n A 1 250 ALA 250 250 250 ALA ALA A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 GLY 252 252 252 GLY GLY A . n A 1 253 GLY 253 253 253 GLY GLY A . n A 1 254 SER 254 254 254 SER SER A . n A 1 255 ILE 255 255 255 ILE ILE A . n A 1 256 ASP 256 256 256 ASP ASP A . n A 1 257 TRP 257 257 257 TRP TRP A . n A 1 258 SER 258 258 258 SER SER A . n A 1 259 TYR 259 259 259 TYR TYR A . n A 1 260 ASN 260 260 260 ASN ASN A . n A 1 261 GLN 261 261 261 GLN GLN A . n A 1 262 GLY 262 262 262 GLY GLY A . n A 1 263 ILE 263 263 263 ILE ILE A . n A 1 264 LYS 264 264 264 LYS LYS A . n A 1 265 TYR 265 265 265 TYR TYR A . n A 1 266 SER 266 266 266 SER SER A . n A 1 267 PHE 267 267 267 PHE PHE A . n A 1 268 THR 268 268 268 THR THR A . n A 1 269 PHE 269 269 269 PHE PHE A . n A 1 270 GLU 270 270 270 GLU GLU A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 ARG 272 272 272 ARG ARG A . n A 1 273 ASP 273 273 273 ASP ASP A . n A 1 274 THR 274 274 274 THR THR A . n A 1 275 GLY 275 275 275 GLY GLY A . n A 1 276 ARG 276 276 276 ARG ARG A . n A 1 277 TYR 277 277 277 TYR TYR A . n A 1 278 GLY 278 278 278 GLY GLY A . n A 1 279 PHE 279 279 279 PHE PHE A . n A 1 280 LEU 280 280 280 LEU LEU A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 PRO 282 282 282 PRO PRO A . n A 1 283 ALA 283 283 283 ALA ALA A . n A 1 284 SER 284 284 284 SER SER A . n A 1 285 GLN 285 285 285 GLN GLN A . n A 1 286 ILE 286 286 286 ILE ILE A . n A 1 287 ILE 287 287 287 ILE ILE A . n A 1 288 PRO 288 288 288 PRO PRO A . n A 1 289 THR 289 289 289 THR THR A . n A 1 290 ALA 290 290 290 ALA ALA A . n A 1 291 GLN 291 291 291 GLN GLN A . n A 1 292 GLU 292 292 292 GLU GLU A . n A 1 293 THR 293 293 293 THR THR A . n A 1 294 TRP 294 294 294 TRP TRP A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 GLY 296 296 296 GLY GLY A . n A 1 297 VAL 297 297 297 VAL VAL A . n A 1 298 LEU 298 298 298 LEU LEU A . n A 1 299 THR 299 299 299 THR THR A . n A 1 300 ILE 300 300 300 ILE ILE A . n A 1 301 MET 301 301 301 MET MET A . n A 1 302 GLU 302 302 302 GLU GLU A . n A 1 303 HIS 303 303 303 HIS HIS A . n A 1 304 THR 304 304 304 THR THR A . n A 1 305 LEU 305 305 305 LEU LEU A . n A 1 306 ASN 306 306 306 ASN ASN A . n A 1 307 ASN 307 307 307 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 308 308 ZN ZN A . C 3 HFA 1 309 309 HFA LOF A . D 4 HOH 1 310 1 HOH HOH A . D 4 HOH 2 311 2 HOH HOH A . D 4 HOH 3 312 3 HOH HOH A . D 4 HOH 4 313 4 HOH HOH A . D 4 HOH 5 314 5 HOH HOH A . D 4 HOH 6 315 6 HOH HOH A . D 4 HOH 7 316 7 HOH HOH A . D 4 HOH 8 317 8 HOH HOH A . D 4 HOH 9 318 9 HOH HOH A . D 4 HOH 10 319 10 HOH HOH A . D 4 HOH 11 320 11 HOH HOH A . D 4 HOH 12 321 12 HOH HOH A . D 4 HOH 13 322 13 HOH HOH A . D 4 HOH 14 323 14 HOH HOH A . D 4 HOH 15 324 15 HOH HOH A . D 4 HOH 16 325 16 HOH HOH A . D 4 HOH 17 326 17 HOH HOH A . D 4 HOH 18 327 18 HOH HOH A . D 4 HOH 19 328 19 HOH HOH A . D 4 HOH 20 329 20 HOH HOH A . D 4 HOH 21 330 21 HOH HOH A . D 4 HOH 22 331 22 HOH HOH A . D 4 HOH 23 332 23 HOH HOH A . D 4 HOH 24 333 24 HOH HOH A . D 4 HOH 25 334 25 HOH HOH A . D 4 HOH 26 335 26 HOH HOH A . D 4 HOH 27 336 27 HOH HOH A . D 4 HOH 28 337 28 HOH HOH A . D 4 HOH 29 338 29 HOH HOH A . D 4 HOH 30 339 30 HOH HOH A . D 4 HOH 31 340 31 HOH HOH A . D 4 HOH 32 341 32 HOH HOH A . D 4 HOH 33 342 33 HOH HOH A . D 4 HOH 34 343 34 HOH HOH A . D 4 HOH 35 344 35 HOH HOH A . D 4 HOH 36 345 36 HOH HOH A . D 4 HOH 37 346 37 HOH HOH A . D 4 HOH 38 347 38 HOH HOH A . D 4 HOH 39 348 39 HOH HOH A . D 4 HOH 40 349 40 HOH HOH A . D 4 HOH 41 350 41 HOH HOH A . D 4 HOH 42 351 42 HOH HOH A . D 4 HOH 43 352 43 HOH HOH A . D 4 HOH 44 353 44 HOH HOH A . D 4 HOH 45 354 45 HOH HOH A . D 4 HOH 46 355 46 HOH HOH A . D 4 HOH 47 356 47 HOH HOH A . D 4 HOH 48 357 48 HOH HOH A . D 4 HOH 49 358 49 HOH HOH A . D 4 HOH 50 359 50 HOH HOH A . D 4 HOH 51 360 51 HOH HOH A . D 4 HOH 52 361 52 HOH HOH A . D 4 HOH 53 362 53 HOH HOH A . D 4 HOH 54 363 54 HOH HOH A . D 4 HOH 55 364 55 HOH HOH A . D 4 HOH 56 365 56 HOH HOH A . D 4 HOH 57 366 57 HOH HOH A . D 4 HOH 58 367 58 HOH HOH A . D 4 HOH 59 368 59 HOH HOH A . D 4 HOH 60 369 60 HOH HOH A . D 4 HOH 61 370 61 HOH HOH A . D 4 HOH 62 371 62 HOH HOH A . D 4 HOH 63 372 63 HOH HOH A . D 4 HOH 64 373 64 HOH HOH A . D 4 HOH 65 374 65 HOH HOH A . D 4 HOH 66 375 66 HOH HOH A . D 4 HOH 67 376 67 HOH HOH A . D 4 HOH 68 377 68 HOH HOH A . D 4 HOH 69 378 69 HOH HOH A . D 4 HOH 70 379 70 HOH HOH A . D 4 HOH 71 380 71 HOH HOH A . D 4 HOH 72 381 72 HOH HOH A . D 4 HOH 73 382 73 HOH HOH A . D 4 HOH 74 383 74 HOH HOH A . D 4 HOH 75 384 75 HOH HOH A . D 4 HOH 76 385 76 HOH HOH A . D 4 HOH 77 386 77 HOH HOH A . D 4 HOH 78 387 78 HOH HOH A . D 4 HOH 79 388 79 HOH HOH A . D 4 HOH 80 389 80 HOH HOH A . D 4 HOH 81 390 81 HOH HOH A . D 4 HOH 82 391 82 HOH HOH A . D 4 HOH 83 392 83 HOH HOH A . D 4 HOH 84 393 84 HOH HOH A . D 4 HOH 85 394 85 HOH HOH A . D 4 HOH 86 395 86 HOH HOH A . D 4 HOH 87 396 87 HOH HOH A . D 4 HOH 88 397 88 HOH HOH A . D 4 HOH 89 398 89 HOH HOH A . D 4 HOH 90 399 90 HOH HOH A . D 4 HOH 91 400 91 HOH HOH A . D 4 HOH 92 401 92 HOH HOH A . D 4 HOH 93 402 93 HOH HOH A . D 4 HOH 94 403 94 HOH HOH A . D 4 HOH 95 404 95 HOH HOH A . D 4 HOH 96 405 96 HOH HOH A . D 4 HOH 97 406 97 HOH HOH A . D 4 HOH 98 407 98 HOH HOH A . D 4 HOH 99 408 99 HOH HOH A . D 4 HOH 100 409 100 HOH HOH A . D 4 HOH 101 410 101 HOH HOH A . D 4 HOH 102 411 102 HOH HOH A . D 4 HOH 103 412 103 HOH HOH A . D 4 HOH 104 413 104 HOH HOH A . D 4 HOH 105 414 105 HOH HOH A . D 4 HOH 106 415 106 HOH HOH A . D 4 HOH 107 416 107 HOH HOH A . D 4 HOH 108 417 108 HOH HOH A . D 4 HOH 109 418 109 HOH HOH A . D 4 HOH 110 419 110 HOH HOH A . D 4 HOH 111 420 111 HOH HOH A . D 4 HOH 112 421 112 HOH HOH A . D 4 HOH 113 422 113 HOH HOH A . D 4 HOH 114 423 114 HOH HOH A . D 4 HOH 115 424 115 HOH HOH A . D 4 HOH 116 425 116 HOH HOH A . D 4 HOH 117 426 117 HOH HOH A . D 4 HOH 118 427 118 HOH HOH A . D 4 HOH 119 428 119 HOH HOH A . D 4 HOH 120 429 120 HOH HOH A . D 4 HOH 121 430 121 HOH HOH A . D 4 HOH 122 431 122 HOH HOH A . D 4 HOH 123 432 123 HOH HOH A . D 4 HOH 124 433 124 HOH HOH A . D 4 HOH 125 434 125 HOH HOH A . D 4 HOH 126 435 126 HOH HOH A . D 4 HOH 127 436 127 HOH HOH A . D 4 HOH 128 437 128 HOH HOH A . D 4 HOH 129 438 129 HOH HOH A . D 4 HOH 130 439 130 HOH HOH A . D 4 HOH 131 440 131 HOH HOH A . D 4 HOH 132 441 132 HOH HOH A . D 4 HOH 133 442 133 HOH HOH A . D 4 HOH 134 443 134 HOH HOH A . D 4 HOH 135 444 135 HOH HOH A . D 4 HOH 136 445 136 HOH HOH A . D 4 HOH 137 446 137 HOH HOH A . D 4 HOH 138 447 138 HOH HOH A . D 4 HOH 139 448 139 HOH HOH A . D 4 HOH 140 449 140 HOH HOH A . D 4 HOH 141 450 141 HOH HOH A . D 4 HOH 142 451 142 HOH HOH A . D 4 HOH 143 452 143 HOH HOH A . D 4 HOH 144 453 144 HOH HOH A . D 4 HOH 145 454 145 HOH HOH A . D 4 HOH 146 455 146 HOH HOH A . D 4 HOH 147 456 147 HOH HOH A . D 4 HOH 148 457 148 HOH HOH A . D 4 HOH 149 458 149 HOH HOH A . D 4 HOH 150 459 150 HOH HOH A . D 4 HOH 151 460 151 HOH HOH A . D 4 HOH 152 461 152 HOH HOH A . D 4 HOH 153 462 153 HOH HOH A . D 4 HOH 154 463 154 HOH HOH A . D 4 HOH 155 464 155 HOH HOH A . D 4 HOH 156 465 156 HOH HOH A . D 4 HOH 157 466 157 HOH HOH A . D 4 HOH 158 467 158 HOH HOH A . D 4 HOH 159 468 159 HOH HOH A . D 4 HOH 160 469 160 HOH HOH A . D 4 HOH 161 470 161 HOH HOH A . D 4 HOH 162 471 162 HOH HOH A . D 4 HOH 163 472 163 HOH HOH A . D 4 HOH 164 473 164 HOH HOH A . D 4 HOH 165 474 165 HOH HOH A . D 4 HOH 166 475 166 HOH HOH A . D 4 HOH 167 476 167 HOH HOH A . D 4 HOH 168 477 168 HOH HOH A . D 4 HOH 169 478 169 HOH HOH A . D 4 HOH 170 479 170 HOH HOH A . D 4 HOH 171 480 171 HOH HOH A . D 4 HOH 172 481 172 HOH HOH A . D 4 HOH 173 482 173 HOH HOH A . D 4 HOH 174 483 174 HOH HOH A . D 4 HOH 175 484 175 HOH HOH A . D 4 HOH 176 485 176 HOH HOH A . D 4 HOH 177 486 177 HOH HOH A . D 4 HOH 178 487 178 HOH HOH A . D 4 HOH 179 488 179 HOH HOH A . D 4 HOH 180 489 180 HOH HOH A . D 4 HOH 181 490 181 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 69 ? A HIS 69 ? 1_555 ZN ? B ZN . ? A ZN 308 ? 1_555 OE1 ? A GLU 72 ? A GLU 72 ? 1_555 119.7 ? 2 ND1 ? A HIS 69 ? A HIS 69 ? 1_555 ZN ? B ZN . ? A ZN 308 ? 1_555 OE2 ? A GLU 72 ? A GLU 72 ? 1_555 94.1 ? 3 OE1 ? A GLU 72 ? A GLU 72 ? 1_555 ZN ? B ZN . ? A ZN 308 ? 1_555 OE2 ? A GLU 72 ? A GLU 72 ? 1_555 55.6 ? 4 ND1 ? A HIS 69 ? A HIS 69 ? 1_555 ZN ? B ZN . ? A ZN 308 ? 1_555 ND1 ? A HIS 196 ? A HIS 196 ? 1_555 101.0 ? 5 OE1 ? A GLU 72 ? A GLU 72 ? 1_555 ZN ? B ZN . ? A ZN 308 ? 1_555 ND1 ? A HIS 196 ? A HIS 196 ? 1_555 95.6 ? 6 OE2 ? A GLU 72 ? A GLU 72 ? 1_555 ZN ? B ZN . ? A ZN 308 ? 1_555 ND1 ? A HIS 196 ? A HIS 196 ? 1_555 151.2 ? 7 ND1 ? A HIS 69 ? A HIS 69 ? 1_555 ZN ? B ZN . ? A ZN 308 ? 1_555 O ? D HOH . ? A HOH 338 ? 1_555 107.9 ? 8 OE1 ? A GLU 72 ? A GLU 72 ? 1_555 ZN ? B ZN . ? A ZN 308 ? 1_555 O ? D HOH . ? A HOH 338 ? 1_555 120.9 ? 9 OE2 ? A GLU 72 ? A GLU 72 ? 1_555 ZN ? B ZN . ? A ZN 308 ? 1_555 O ? D HOH . ? A HOH 338 ? 1_555 89.9 ? 10 ND1 ? A HIS 196 ? A HIS 196 ? 1_555 ZN ? B ZN . ? A ZN 308 ? 1_555 O ? D HOH . ? A HOH 338 ? 1_555 108.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-01-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_conf 3 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # _software.name PROLSQ _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A GLN 31 ? ? CG A GLN 31 ? ? CD A GLN 31 ? ? 128.97 111.60 17.37 2.60 N 2 1 NE A ARG 40 ? ? CZ A ARG 40 ? ? NH1 A ARG 40 ? ? 124.50 120.30 4.20 0.50 N 3 1 NE A ARG 40 ? ? CZ A ARG 40 ? ? NH2 A ARG 40 ? ? 111.64 120.30 -8.66 0.50 N 4 1 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH2 A ARG 45 ? ? 115.98 120.30 -4.32 0.50 N 5 1 NE A ARG 59 ? ? CZ A ARG 59 ? ? NH1 A ARG 59 ? ? 116.32 120.30 -3.98 0.50 N 6 1 CD A ARG 71 ? ? NE A ARG 71 ? ? CZ A ARG 71 ? ? 114.20 123.60 -9.40 1.40 N 7 1 NE A ARG 71 ? ? CZ A ARG 71 ? ? NH2 A ARG 71 ? ? 116.96 120.30 -3.34 0.50 N 8 1 CB A PHE 82 ? ? CG A PHE 82 ? ? CD2 A PHE 82 ? ? 116.27 120.80 -4.53 0.70 N 9 1 CB A ASP 101 ? ? CG A ASP 101 ? ? OD1 A ASP 101 ? ? 125.11 118.30 6.81 0.90 N 10 1 NE A ARG 130 ? ? CZ A ARG 130 ? ? NH1 A ARG 130 ? ? 125.53 120.30 5.23 0.50 N 11 1 NE A ARG 130 ? ? CZ A ARG 130 ? ? NH2 A ARG 130 ? ? 116.89 120.30 -3.41 0.50 N 12 1 CB A TYR 234 ? ? CG A TYR 234 ? ? CD2 A TYR 234 ? ? 124.91 121.00 3.91 0.60 N 13 1 CB A TYR 240 ? ? CG A TYR 240 ? ? CD1 A TYR 240 ? ? 117.39 121.00 -3.61 0.60 N 14 1 NE A ARG 272 ? ? CZ A ARG 272 ? ? NH2 A ARG 272 ? ? 117.16 120.30 -3.14 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 58 ? ? 38.55 59.18 2 1 THR A 129 ? ? -75.54 -168.84 3 1 SER A 135 ? ? -91.65 43.29 4 1 SER A 199 ? ? 147.20 -16.75 5 1 GLN A 200 ? ? 60.80 64.93 6 1 ILE A 247 ? ? -108.46 -74.56 7 1 ASP A 273 ? ? -107.78 -144.39 8 1 LEU A 280 ? ? -96.30 49.57 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'ALPHA-HYDROXY-BETA-PHENYL-PROPIONIC ACID' HFA 4 water HOH #