data_2D7L # _entry.id 2D7L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2D7L pdb_00002d7l 10.2210/pdb2d7l/pdb RCSB RCSB025086 ? ? WWPDB D_1000025086 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso002001226.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2D7L _pdbx_database_status.recvd_initial_deposition_date 2005-11-24 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tomizawa, T.' 1 'Kigawa, T.' 2 'Saito, K.' 3 'Koshiba, S.' 4 'Inoue, M.' 5 'Kamatari, Y.O.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the HMG box domain from human WD repeat and HMG-box DNA binding protein 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tomizawa, T.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Saito, K.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Inoue, M.' 5 ? primary 'Kamatari, Y.O.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'WD repeat and HMG-box DNA binding protein 1' _entity.formula_weight 8877.777 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'HMG box domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Acidic nucleoplasmic DNA- binding protein 1, And-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGRPKTGFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKSGPSS G ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGRPKTGFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKSGPSS G ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso002001226.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ARG n 1 9 PRO n 1 10 LYS n 1 11 THR n 1 12 GLY n 1 13 PHE n 1 14 GLN n 1 15 MET n 1 16 TRP n 1 17 LEU n 1 18 GLU n 1 19 GLU n 1 20 ASN n 1 21 ARG n 1 22 SER n 1 23 ASN n 1 24 ILE n 1 25 LEU n 1 26 SER n 1 27 ASP n 1 28 ASN n 1 29 PRO n 1 30 ASP n 1 31 PHE n 1 32 SER n 1 33 ASP n 1 34 GLU n 1 35 ALA n 1 36 ASP n 1 37 ILE n 1 38 ILE n 1 39 LYS n 1 40 GLU n 1 41 GLY n 1 42 MET n 1 43 ILE n 1 44 ARG n 1 45 PHE n 1 46 ARG n 1 47 VAL n 1 48 LEU n 1 49 SER n 1 50 THR n 1 51 GLU n 1 52 GLU n 1 53 ARG n 1 54 LYS n 1 55 VAL n 1 56 TRP n 1 57 ALA n 1 58 ASN n 1 59 LYS n 1 60 ALA n 1 61 LYS n 1 62 GLY n 1 63 GLU n 1 64 THR n 1 65 ALA n 1 66 SER n 1 67 GLU n 1 68 GLY n 1 69 THR n 1 70 GLU n 1 71 ALA n 1 72 LYS n 1 73 LYS n 1 74 ARG n 1 75 LYS n 1 76 SER n 1 77 GLY n 1 78 PRO n 1 79 SER n 1 80 SER n 1 81 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene WDHD1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050111-08 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code WDHD1_HUMAN _struct_ref.pdbx_db_accession O75717 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RPKTGFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRK _struct_ref.pdbx_align_begin 1017 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2D7L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O75717 _struct_ref_seq.db_align_beg 1017 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1084 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2D7L GLY A 1 ? UNP O75717 ? ? 'cloning artifact' 1 1 1 2D7L SER A 2 ? UNP O75717 ? ? 'cloning artifact' 2 2 1 2D7L SER A 3 ? UNP O75717 ? ? 'cloning artifact' 3 3 1 2D7L GLY A 4 ? UNP O75717 ? ? 'cloning artifact' 4 4 1 2D7L SER A 5 ? UNP O75717 ? ? 'cloning artifact' 5 5 1 2D7L SER A 6 ? UNP O75717 ? ? 'cloning artifact' 6 6 1 2D7L GLY A 7 ? UNP O75717 ? ? 'cloning artifact' 7 7 1 2D7L SER A 76 ? UNP O75717 ? ? 'cloning artifact' 76 8 1 2D7L GLY A 77 ? UNP O75717 ? ? 'cloning artifact' 77 9 1 2D7L PRO A 78 ? UNP O75717 ? ? 'cloning artifact' 78 10 1 2D7L SER A 79 ? UNP O75717 ? ? 'cloning artifact' 79 11 1 2D7L SER A 80 ? UNP O75717 ? ? 'cloning artifact' 80 12 1 2D7L GLY A 81 ? UNP O75717 ? ? 'cloning artifact' 81 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.13mM HMG box domain U-15N, 13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2D7L _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2D7L _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2D7L _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2D7L _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2D7L _struct.title 'Solution structure of the HMG box domain from human WD repeat and HMG-box DNA binding protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2D7L _struct_keywords.pdbx_keywords 'GENE REGULATION, DNA BINDING PROTEIN' _struct_keywords.text ;high mobility group box domain, helix-turn-helix, DNA binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION, DNA BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 11 ? ASN A 28 ? THR A 11 ASN A 28 1 ? 18 HELX_P HELX_P2 2 ASP A 33 ? ARG A 46 ? ASP A 33 ARG A 46 1 ? 14 HELX_P HELX_P3 3 SER A 49 ? ALA A 60 ? SER A 49 ALA A 60 1 ? 12 HELX_P HELX_P4 4 ALA A 71 ? LYS A 75 ? ALA A 71 LYS A 75 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2D7L _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2D7L _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLY 81 81 81 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-05-24 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 9 ? ? -69.78 -174.40 2 1 ARG A 74 ? ? 35.35 40.06 3 1 SER A 80 ? ? -47.12 107.41 4 2 SER A 6 ? ? -34.51 138.53 5 2 LYS A 10 ? ? -34.38 140.03 6 2 LEU A 48 ? ? -44.75 159.00 7 2 LYS A 72 ? ? -173.23 125.49 8 4 LYS A 10 ? ? -59.66 171.84 9 4 LYS A 73 ? ? 37.23 47.32 10 5 THR A 50 ? ? -39.68 -30.80 11 5 GLU A 70 ? ? -126.31 -55.32 12 6 PRO A 9 ? ? -69.74 -179.11 13 6 LEU A 48 ? ? -44.60 162.02 14 6 THR A 50 ? ? -34.29 -33.58 15 6 ALA A 65 ? ? -39.74 117.99 16 6 ARG A 74 ? ? -171.61 133.34 17 6 SER A 79 ? ? -39.07 148.02 18 7 ASP A 30 ? ? -38.98 -32.84 19 7 LEU A 48 ? ? -43.25 163.46 20 7 THR A 50 ? ? -35.83 -30.63 21 7 PRO A 78 ? ? -69.75 96.87 22 8 SER A 2 ? ? -54.88 175.49 23 8 LEU A 48 ? ? -46.96 156.55 24 8 THR A 50 ? ? -37.58 -28.00 25 8 GLU A 63 ? ? -38.30 105.86 26 8 SER A 76 ? ? -38.85 158.39 27 9 LEU A 48 ? ? -43.35 161.27 28 9 THR A 50 ? ? -35.81 -30.93 29 9 THR A 64 ? ? -38.34 122.66 30 9 ALA A 65 ? ? -47.50 98.49 31 9 SER A 66 ? ? -49.88 92.14 32 10 LEU A 48 ? ? -42.31 159.31 33 10 THR A 50 ? ? -36.00 -31.37 34 10 GLU A 63 ? ? -42.77 153.92 35 10 THR A 64 ? ? -34.31 114.85 36 10 SER A 66 ? ? -41.82 151.76 37 10 SER A 76 ? ? -47.10 172.48 38 11 PRO A 9 ? ? -69.69 -177.68 39 11 LEU A 48 ? ? -43.21 161.84 40 11 THR A 50 ? ? -36.48 -30.62 41 11 GLU A 63 ? ? -47.81 93.20 42 11 ALA A 71 ? ? -174.87 143.71 43 11 LYS A 72 ? ? -46.15 100.64 44 11 LYS A 73 ? ? -46.99 167.94 45 11 SER A 80 ? ? -53.33 172.62 46 12 LEU A 48 ? ? -43.42 156.39 47 12 THR A 50 ? ? -34.42 -32.89 48 12 GLU A 63 ? ? -95.54 58.52 49 12 SER A 76 ? ? -36.61 153.48 50 13 LYS A 10 ? ? -39.50 139.71 51 13 LEU A 48 ? ? -44.64 156.95 52 13 THR A 50 ? ? -39.19 -25.62 53 13 THR A 64 ? ? -36.59 142.84 54 14 LEU A 48 ? ? -41.90 157.96 55 14 THR A 50 ? ? -36.19 -31.14 56 14 GLU A 63 ? ? -58.59 85.35 57 14 THR A 69 ? ? -69.94 94.07 58 14 LYS A 72 ? ? -174.91 125.23 59 15 LEU A 48 ? ? -42.61 156.53 60 15 THR A 50 ? ? -37.98 -31.46 61 16 SER A 2 ? ? -45.22 164.74 62 16 LEU A 48 ? ? -46.86 157.75 63 16 THR A 50 ? ? -36.52 -29.87 64 16 GLU A 63 ? ? -39.03 102.60 65 17 SER A 2 ? ? -53.16 105.37 66 17 LEU A 48 ? ? -43.49 161.46 67 17 THR A 50 ? ? -37.12 -29.71 68 17 LYS A 61 ? ? -41.15 -74.73 69 17 THR A 64 ? ? -41.55 153.82 70 17 PRO A 78 ? ? -69.71 -168.01 71 17 SER A 79 ? ? 38.82 45.90 72 18 ARG A 8 ? ? -36.34 143.98 73 18 LYS A 10 ? ? -35.85 135.21 74 18 LEU A 48 ? ? -41.52 156.93 75 18 LYS A 72 ? ? -165.97 114.78 76 19 SER A 5 ? ? -130.89 -44.66 77 19 ASP A 30 ? ? -39.43 -33.97 78 19 LEU A 48 ? ? -40.52 157.73 79 19 THR A 50 ? ? -37.23 -30.15 80 19 THR A 69 ? ? 36.13 39.87 81 20 ARG A 8 ? ? -39.32 154.20 82 20 PRO A 9 ? ? -69.81 -170.74 83 20 LEU A 48 ? ? -42.90 160.47 84 20 THR A 50 ? ? -37.73 -27.64 85 20 GLU A 63 ? ? -37.30 -28.54 86 20 PRO A 78 ? ? -69.74 2.52 87 20 SER A 79 ? ? -38.76 104.74 #