data_2DAF # _entry.id 2DAF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DAF pdb_00002daf 10.2210/pdb2daf/pdb RCSB RCSB025182 ? ? WWPDB D_1000025182 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002026853.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DAF _pdbx_database_status.recvd_initial_deposition_date 2005-12-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhao, C.' 1 'Kigawa, T.' 2 'Saito, K.' 3 'Koshiba, S.' 4 'Inoue, M.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution Structure of the Novel Identified Ubiquitin-like Domain in the Human Hypothetical Protein FLJ35834' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhao, C.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Saito, K.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Inoue, M.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'FLJ35834 protein' _entity.formula_weight 12818.606 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'ubiquitin-like domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGQESVEDSLATVKVVLIPVGQEIVIPFKVDTILKYLKDHFSHLLGIPHSVLQIRYSGKILKNNETLVQHGVKPQ EIVQVEIFSTNPDLYPVRRIDGLTDVSQIITVSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGQESVEDSLATVKVVLIPVGQEIVIPFKVDTILKYLKDHFSHLLGIPHSVLQIRYSGKILKNNETLVQHGVKPQ EIVQVEIFSTNPDLYPVRRIDGLTDVSQIITVSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002026853.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLN n 1 9 GLU n 1 10 SER n 1 11 VAL n 1 12 GLU n 1 13 ASP n 1 14 SER n 1 15 LEU n 1 16 ALA n 1 17 THR n 1 18 VAL n 1 19 LYS n 1 20 VAL n 1 21 VAL n 1 22 LEU n 1 23 ILE n 1 24 PRO n 1 25 VAL n 1 26 GLY n 1 27 GLN n 1 28 GLU n 1 29 ILE n 1 30 VAL n 1 31 ILE n 1 32 PRO n 1 33 PHE n 1 34 LYS n 1 35 VAL n 1 36 ASP n 1 37 THR n 1 38 ILE n 1 39 LEU n 1 40 LYS n 1 41 TYR n 1 42 LEU n 1 43 LYS n 1 44 ASP n 1 45 HIS n 1 46 PHE n 1 47 SER n 1 48 HIS n 1 49 LEU n 1 50 LEU n 1 51 GLY n 1 52 ILE n 1 53 PRO n 1 54 HIS n 1 55 SER n 1 56 VAL n 1 57 LEU n 1 58 GLN n 1 59 ILE n 1 60 ARG n 1 61 TYR n 1 62 SER n 1 63 GLY n 1 64 LYS n 1 65 ILE n 1 66 LEU n 1 67 LYS n 1 68 ASN n 1 69 ASN n 1 70 GLU n 1 71 THR n 1 72 LEU n 1 73 VAL n 1 74 GLN n 1 75 HIS n 1 76 GLY n 1 77 VAL n 1 78 LYS n 1 79 PRO n 1 80 GLN n 1 81 GLU n 1 82 ILE n 1 83 VAL n 1 84 GLN n 1 85 VAL n 1 86 GLU n 1 87 ILE n 1 88 PHE n 1 89 SER n 1 90 THR n 1 91 ASN n 1 92 PRO n 1 93 ASP n 1 94 LEU n 1 95 TYR n 1 96 PRO n 1 97 VAL n 1 98 ARG n 1 99 ARG n 1 100 ILE n 1 101 ASP n 1 102 GLY n 1 103 LEU n 1 104 THR n 1 105 ASP n 1 106 VAL n 1 107 SER n 1 108 GLN n 1 109 ILE n 1 110 ILE n 1 111 THR n 1 112 VAL n 1 113 SER n 1 114 GLY n 1 115 PRO n 1 116 SER n 1 117 SER n 1 118 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene FLJ35834 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050125-04 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6NUH6_HUMAN _struct_ref.pdbx_db_accession Q6NUH6 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 121 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DAF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 112 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6NUH6 _struct_ref_seq.db_align_beg 121 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 227 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 112 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DAF GLY A 1 ? UNP Q6NUH6 ? ? 'cloning artifact' 1 1 1 2DAF SER A 2 ? UNP Q6NUH6 ? ? 'cloning artifact' 2 2 1 2DAF SER A 3 ? UNP Q6NUH6 ? ? 'cloning artifact' 3 3 1 2DAF GLY A 4 ? UNP Q6NUH6 ? ? 'cloning artifact' 4 4 1 2DAF SER A 5 ? UNP Q6NUH6 ? ? 'cloning artifact' 5 5 1 2DAF SER A 6 ? UNP Q6NUH6 ? ? 'cloning artifact' 6 6 1 2DAF GLY A 7 ? UNP Q6NUH6 ? ? 'cloning artifact' 7 7 1 2DAF SER A 113 ? UNP Q6NUH6 ? ? 'cloning artifact' 113 8 1 2DAF GLY A 114 ? UNP Q6NUH6 ? ? 'cloning artifact' 114 9 1 2DAF PRO A 115 ? UNP Q6NUH6 ? ? 'cloning artifact' 115 10 1 2DAF SER A 116 ? UNP Q6NUH6 ? ? 'cloning artifact' 116 11 1 2DAF SER A 117 ? UNP Q6NUH6 ? ? 'cloning artifact' 117 12 1 2DAF GLY A 118 ? UNP Q6NUH6 ? ? 'cloning artifact' 118 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.29mM ubiquitin-like domain U-15N, 13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DAF _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DAF _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DAF _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9321 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DAF _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DAF _struct.title 'Solution Structure of the Novel Identified Ubiquitin-like Domain in the Human Hypothetical Protein FLJ35834' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DAF _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 38 ? GLY A 51 ? ILE A 38 GLY A 51 1 ? 14 HELX_P HELX_P2 2 THR A 71 ? GLY A 76 ? THR A 71 GLY A 76 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 28 ? PHE A 33 ? GLU A 28 PHE A 33 A 2 ALA A 16 ? LEU A 22 ? ALA A 16 LEU A 22 A 3 ILE A 82 ? SER A 89 ? ILE A 82 SER A 89 A 4 LEU A 57 ? TYR A 61 ? LEU A 57 TYR A 61 A 5 LYS A 64 ? LEU A 66 ? LYS A 64 LEU A 66 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 29 ? O ILE A 29 N VAL A 20 ? N VAL A 20 A 2 3 N LYS A 19 ? N LYS A 19 O VAL A 85 ? O VAL A 85 A 3 4 O PHE A 88 ? O PHE A 88 N GLN A 58 ? N GLN A 58 A 4 5 N TYR A 61 ? N TYR A 61 O LYS A 64 ? O LYS A 64 # _database_PDB_matrix.entry_id 2DAF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DAF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 GLY 118 118 118 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 9 ? ? -171.51 118.25 2 1 ASP A 44 ? ? -34.92 -32.40 3 1 PRO A 115 ? ? -69.69 -175.66 4 1 SER A 116 ? ? -63.69 -178.28 5 2 SER A 3 ? ? -172.05 139.13 6 2 ILE A 38 ? ? -46.78 167.18 7 2 PHE A 46 ? ? -91.12 -64.65 8 2 THR A 111 ? ? -34.75 -72.00 9 3 SER A 14 ? ? -106.51 46.27 10 3 HIS A 45 ? ? -36.41 -38.56 11 3 SER A 117 ? ? -35.78 122.49 12 4 GLN A 80 ? ? 73.93 44.63 13 4 ASP A 105 ? ? -108.79 64.28 14 5 GLU A 12 ? ? 38.31 44.49 15 5 THR A 104 ? ? -132.38 -43.00 16 5 PRO A 115 ? ? -69.79 -170.10 17 6 SER A 3 ? ? -40.93 156.95 18 6 ASP A 13 ? ? -109.87 74.75 19 6 ILE A 38 ? ? -48.15 175.76 20 6 ASP A 101 ? ? -36.11 140.67 21 6 GLN A 108 ? ? -132.36 -34.84 22 6 PRO A 115 ? ? -69.66 -174.52 23 7 SER A 2 ? ? -63.54 96.83 24 7 SER A 3 ? ? -62.41 99.95 25 7 SER A 14 ? ? -93.88 44.26 26 7 ILE A 38 ? ? -34.78 152.12 27 7 LEU A 66 ? ? -66.75 -177.93 28 7 LEU A 103 ? ? 37.63 31.36 29 7 ILE A 110 ? ? -171.08 126.30 30 7 SER A 113 ? ? -57.14 101.28 31 7 SER A 116 ? ? -170.71 134.70 32 8 GLU A 12 ? ? 35.76 43.10 33 8 ASP A 36 ? ? -99.21 33.43 34 8 LYS A 43 ? ? -54.97 -73.11 35 8 LEU A 103 ? ? -132.07 -64.78 36 8 ASP A 105 ? ? 74.03 54.74 37 8 SER A 113 ? ? -172.94 148.00 38 8 PRO A 115 ? ? -69.73 -173.54 39 9 ILE A 38 ? ? -48.47 152.66 40 9 HIS A 45 ? ? -38.58 -32.18 41 9 GLU A 70 ? ? -55.31 174.54 42 9 ASN A 91 ? ? -109.38 79.42 43 9 PRO A 115 ? ? -69.74 -173.80 44 10 ILE A 38 ? ? -48.02 165.14 45 10 ILE A 110 ? ? -170.34 145.59 46 10 THR A 111 ? ? -36.17 136.43 47 10 VAL A 112 ? ? -39.61 137.48 48 11 ILE A 38 ? ? -53.14 176.84 49 11 ASP A 105 ? ? -62.72 93.97 50 11 ILE A 109 ? ? -171.87 125.08 51 11 ILE A 110 ? ? -170.58 124.39 52 11 SER A 113 ? ? -167.19 109.43 53 11 PRO A 115 ? ? -69.73 -171.65 54 12 GLU A 9 ? ? -34.77 138.03 55 12 ILE A 38 ? ? -41.44 156.67 56 12 ASN A 69 ? ? -49.49 -18.61 57 13 GLU A 12 ? ? -91.21 58.41 58 13 ASP A 36 ? ? -86.45 33.57 59 13 ILE A 38 ? ? -56.36 172.00 60 13 LEU A 103 ? ? -38.86 135.96 61 13 PRO A 115 ? ? -69.74 -176.99 62 14 GLU A 9 ? ? -90.37 42.20 63 14 LYS A 40 ? ? -36.35 -34.79 64 14 ASN A 91 ? ? -114.85 79.43 65 14 ARG A 99 ? ? -53.89 171.63 66 14 THR A 104 ? ? -46.71 106.71 67 14 VAL A 106 ? ? -34.05 126.99 68 14 THR A 111 ? ? -43.70 97.78 69 14 SER A 117 ? ? -173.97 127.60 70 15 SER A 5 ? ? -164.55 113.48 71 15 VAL A 11 ? ? -93.36 -64.60 72 15 ILE A 38 ? ? -46.58 173.00 73 15 HIS A 54 ? ? -36.62 -32.28 74 15 GLU A 70 ? ? -49.64 158.60 75 15 ARG A 99 ? ? -55.55 -174.91 76 15 ASP A 101 ? ? -39.30 131.54 77 15 ASP A 105 ? ? -39.95 154.90 78 15 VAL A 106 ? ? -33.97 132.89 79 15 ILE A 110 ? ? -172.07 144.16 80 15 PRO A 115 ? ? -69.73 -171.57 81 16 SER A 3 ? ? 35.82 42.08 82 16 ILE A 38 ? ? -47.10 173.70 83 16 THR A 104 ? ? -35.39 148.24 84 16 ASP A 105 ? ? -50.14 174.31 85 16 VAL A 112 ? ? -35.92 112.10 86 16 PRO A 115 ? ? -69.65 -176.06 87 17 GLU A 12 ? ? -119.96 66.75 88 17 THR A 17 ? ? -65.26 97.57 89 17 ILE A 38 ? ? -43.62 156.23 90 17 THR A 104 ? ? -172.75 147.54 91 17 ASP A 105 ? ? -173.64 114.82 92 18 SER A 2 ? ? 34.63 42.07 93 18 GLU A 12 ? ? -96.57 44.18 94 18 LYS A 43 ? ? -57.82 -70.18 95 18 ASP A 44 ? ? -39.11 -36.48 96 18 ASP A 101 ? ? -41.15 160.77 97 18 SER A 113 ? ? -46.15 161.39 98 19 SER A 6 ? ? -171.51 131.43 99 19 LEU A 15 ? ? -39.74 140.38 100 19 ASP A 36 ? ? -87.54 35.63 101 19 LYS A 40 ? ? -33.14 -71.06 102 19 GLN A 108 ? ? -107.85 41.94 103 19 THR A 111 ? ? -45.69 99.81 104 19 SER A 113 ? ? -35.22 125.36 105 19 PRO A 115 ? ? -69.75 -167.86 106 19 SER A 117 ? ? -170.44 143.68 107 20 GLN A 8 ? ? -169.71 112.72 108 20 SER A 10 ? ? -99.47 43.05 109 20 LEU A 15 ? ? -39.40 146.19 110 20 ILE A 38 ? ? -47.46 172.09 111 20 LYS A 40 ? ? -32.14 -71.24 112 20 HIS A 45 ? ? -34.61 -39.33 113 20 LEU A 66 ? ? -69.83 -177.68 114 20 ASN A 68 ? ? -68.96 -71.41 115 20 SER A 113 ? ? -35.18 139.06 #