data_2DAN # _entry.id 2DAN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DAN pdb_00002dan 10.2210/pdb2dan/pdb RCSB RCSB025190 ? ? WWPDB D_1000025190 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.value' 18 4 'Structure model' '_struct_conn.pdbx_dist_value' 19 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 31 4 'Structure model' '_struct_ref_seq_dif.details' 32 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 33 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 34 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DAN _pdbx_database_status.recvd_initial_deposition_date 2005-12-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2D8Q 'the same protein domain of the different length' unspecified TargetDB hss001004006.1 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sasagawa, A.' 1 'Miyamoto, K.' 2 'Tochio, N.' 3 'Koshiba, S.' 4 'Inoue, M.' 5 'Kigawa, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title ;The solution structure of the MYND domain (LEU384-CYS430) of human Zinc finger MYND domain containing protein 10 ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sasagawa, A.' 1 ? primary 'Miyamoto, K.' 2 ? primary 'Tochio, N.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Inoue, M.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Yokoyama, S.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger MYND domain containing protein 10' 6538.294 1 ? ? 'MYND domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BLu protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001004006.1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LEU n 1 9 GLU n 1 10 ALA n 1 11 VAL n 1 12 ALA n 1 13 PRO n 1 14 GLU n 1 15 ARG n 1 16 PRO n 1 17 ARG n 1 18 CYS n 1 19 ALA n 1 20 TYR n 1 21 CYS n 1 22 SER n 1 23 ALA n 1 24 GLU n 1 25 ALA n 1 26 SER n 1 27 LYS n 1 28 ARG n 1 29 CYS n 1 30 SER n 1 31 ARG n 1 32 CYS n 1 33 GLN n 1 34 ASN n 1 35 GLU n 1 36 TRP n 1 37 TYR n 1 38 CYS n 1 39 CYS n 1 40 ARG n 1 41 GLU n 1 42 CYS n 1 43 GLN n 1 44 VAL n 1 45 LYS n 1 46 HIS n 1 47 TRP n 1 48 GLU n 1 49 LYS n 1 50 HIS n 1 51 GLY n 1 52 LYS n 1 53 THR n 1 54 CYS n 1 55 SER n 1 56 GLY n 1 57 PRO n 1 58 SER n 1 59 SER n 1 60 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ZMYND10 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050302-43 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLY 60 60 60 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _exptl.entry_id 2DAN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2DAN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2DAN _struct.title 'The solution structure of the MYND domain (LEU384-CYS430) of human Zinc finger MYND domain containing protein 10' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DAN _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;zf-MYND, BLu protein, C3H, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZMY10_HUMAN _struct_ref.pdbx_db_accession O75800 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 384 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DAN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 54 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O75800 _struct_ref_seq.db_align_beg 384 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 430 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 54 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DAN GLY A 1 ? UNP O75800 ? ? 'cloning artifact' 1 1 1 2DAN SER A 2 ? UNP O75800 ? ? 'cloning artifact' 2 2 1 2DAN SER A 3 ? UNP O75800 ? ? 'cloning artifact' 3 3 1 2DAN GLY A 4 ? UNP O75800 ? ? 'cloning artifact' 4 4 1 2DAN SER A 5 ? UNP O75800 ? ? 'cloning artifact' 5 5 1 2DAN SER A 6 ? UNP O75800 ? ? 'cloning artifact' 6 6 1 2DAN GLY A 7 ? UNP O75800 ? ? 'cloning artifact' 7 7 1 2DAN SER A 55 ? UNP O75800 ? ? 'cloning artifact' 55 8 1 2DAN GLY A 56 ? UNP O75800 ? ? 'cloning artifact' 56 9 1 2DAN PRO A 57 ? UNP O75800 ? ? 'cloning artifact' 57 10 1 2DAN SER A 58 ? UNP O75800 ? ? 'cloning artifact' 58 11 1 2DAN SER A 59 ? UNP O75800 ? ? 'cloning artifact' 59 12 1 2DAN GLY A 60 ? UNP O75800 ? ? 'cloning artifact' 60 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 39 ? HIS A 46 ? CYS A 39 HIS A 46 1 ? 8 HELX_P HELX_P2 2 HIS A 46 ? GLY A 51 ? HIS A 46 GLY A 51 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 18 A ZN 401 1_555 ? ? ? ? ? ? ? 2.375 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 21 A ZN 401 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc3 metalc ? ? A CYS 29 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 29 A ZN 201 1_555 ? ? ? ? ? ? ? 2.345 ? ? metalc4 metalc ? ? A CYS 32 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 32 A ZN 201 1_555 ? ? ? ? ? ? ? 2.322 ? ? metalc5 metalc ? ? A CYS 38 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 38 A ZN 401 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc6 metalc ? ? A CYS 42 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 42 A ZN 401 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc7 metalc ? ? A HIS 50 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 50 A ZN 201 1_555 ? ? ? ? ? ? ? 2.337 ? ? metalc8 metalc ? ? A CYS 54 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 54 A ZN 201 1_555 ? ? ? ? ? ? ? 2.321 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 104.9 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 117.0 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 99.8 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 98.4 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 118.3 ? 6 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 118.5 ? 7 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 117.1 ? 8 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 89.2 ? 9 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 97.1 ? 10 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 118.3 ? 11 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 119.2 ? 12 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 106.5 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 27 ? ARG A 28 ? LYS A 27 ARG A 28 A 2 TRP A 36 ? TYR A 37 ? TRP A 36 TYR A 37 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 27 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 27 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 37 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 37 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 5 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 29 ? CYS A 29 . ? 1_555 ? 2 AC1 5 ARG A 31 ? ARG A 31 . ? 1_555 ? 3 AC1 5 CYS A 32 ? CYS A 32 . ? 1_555 ? 4 AC1 5 HIS A 50 ? HIS A 50 . ? 1_555 ? 5 AC1 5 CYS A 54 ? CYS A 54 . ? 1_555 ? 6 AC2 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 7 AC2 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 8 AC2 4 CYS A 38 ? CYS A 38 . ? 1_555 ? 9 AC2 4 CYS A 42 ? CYS A 42 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 10 ? ? -63.66 94.43 2 1 PRO A 13 ? ? -69.71 -163.59 3 1 PRO A 16 ? ? -69.78 -163.82 4 1 GLU A 24 ? ? -41.65 109.93 5 1 CYS A 54 ? ? -46.02 164.83 6 1 PRO A 57 ? ? -69.77 80.78 7 1 SER A 58 ? ? -37.19 136.80 8 1 SER A 59 ? ? -173.74 145.39 9 2 LEU A 8 ? ? -106.95 40.56 10 2 PRO A 13 ? ? -69.79 -163.64 11 2 PRO A 16 ? ? -69.80 -163.46 12 2 GLU A 24 ? ? -43.29 109.27 13 2 GLU A 48 ? ? -36.02 -30.44 14 2 CYS A 54 ? ? -46.57 165.66 15 2 PRO A 57 ? ? -69.77 4.98 16 2 SER A 59 ? ? -62.37 88.92 17 3 PRO A 13 ? ? -69.79 -164.73 18 3 PRO A 16 ? ? -69.73 -163.40 19 3 GLU A 24 ? ? -44.67 109.63 20 3 GLU A 48 ? ? -36.56 -35.03 21 3 CYS A 54 ? ? -48.89 166.33 22 3 PRO A 57 ? ? -69.75 -171.71 23 3 SER A 59 ? ? -51.60 95.97 24 4 SER A 3 ? ? -92.25 42.17 25 4 ALA A 10 ? ? -45.63 98.56 26 4 PRO A 13 ? ? -69.76 -164.56 27 4 PRO A 16 ? ? -69.73 -163.88 28 4 GLU A 48 ? ? -36.21 -33.79 29 4 CYS A 54 ? ? -48.20 165.71 30 5 LEU A 8 ? ? 35.92 39.72 31 5 GLU A 9 ? ? -55.54 92.65 32 5 PRO A 13 ? ? -69.73 -163.70 33 5 PRO A 16 ? ? -69.75 -164.01 34 5 GLU A 48 ? ? -36.16 -36.92 35 5 SER A 58 ? ? -175.54 148.13 36 6 PRO A 16 ? ? -69.73 -163.37 37 6 GLU A 24 ? ? -44.78 107.73 38 6 GLU A 48 ? ? -36.27 -37.02 39 6 CYS A 54 ? ? -47.53 167.83 40 6 SER A 58 ? ? -103.26 46.12 41 7 SER A 5 ? ? -82.97 41.05 42 7 LEU A 8 ? ? -103.81 41.54 43 7 PRO A 16 ? ? -69.78 -163.76 44 7 GLU A 48 ? ? -36.05 -30.92 45 7 CYS A 54 ? ? -49.91 166.23 46 7 PRO A 57 ? ? -69.74 -167.57 47 8 SER A 2 ? ? -107.32 41.27 48 8 LEU A 8 ? ? -53.47 98.82 49 8 PRO A 13 ? ? -69.70 -163.99 50 8 PRO A 16 ? ? -69.80 -163.86 51 8 GLU A 24 ? ? -52.63 108.22 52 8 GLU A 48 ? ? -35.95 -36.61 53 9 PRO A 16 ? ? -69.76 -163.73 54 9 GLU A 24 ? ? -47.22 109.54 55 9 GLU A 48 ? ? -35.96 -30.48 56 9 CYS A 54 ? ? -47.79 167.62 57 9 PRO A 57 ? ? -69.82 81.59 58 10 LEU A 8 ? ? -36.13 98.24 59 10 PRO A 13 ? ? -69.77 -164.23 60 10 PRO A 16 ? ? -69.75 -164.12 61 10 GLU A 48 ? ? -36.23 -38.25 62 10 CYS A 54 ? ? -48.68 165.85 63 11 SER A 6 ? ? -166.49 106.98 64 11 PRO A 16 ? ? -69.77 -164.04 65 11 GLU A 24 ? ? -47.01 109.08 66 11 CYS A 54 ? ? -48.54 165.88 67 11 SER A 58 ? ? -34.17 146.27 68 12 SER A 6 ? ? -160.00 113.84 69 12 LEU A 8 ? ? -81.24 42.06 70 12 PRO A 16 ? ? -69.75 -163.50 71 12 GLU A 24 ? ? -42.72 109.72 72 12 GLU A 48 ? ? -36.10 -33.43 73 12 CYS A 54 ? ? -48.12 166.85 74 12 PRO A 57 ? ? -69.79 79.83 75 12 SER A 58 ? ? -134.83 -46.69 76 13 SER A 5 ? ? -50.69 104.63 77 13 PRO A 13 ? ? -69.78 -163.25 78 13 PRO A 16 ? ? -69.79 -163.80 79 13 GLU A 24 ? ? -47.02 108.69 80 13 GLU A 48 ? ? -36.20 -35.43 81 13 CYS A 54 ? ? -49.07 169.38 82 14 PRO A 13 ? ? -69.78 -163.75 83 14 PRO A 16 ? ? -69.75 -163.61 84 14 GLU A 24 ? ? -42.53 109.89 85 14 GLU A 48 ? ? -36.10 -35.45 86 14 CYS A 54 ? ? -49.65 164.73 87 15 SER A 5 ? ? -95.28 40.52 88 15 LEU A 8 ? ? -51.82 93.19 89 15 PRO A 13 ? ? -69.75 -165.43 90 15 PRO A 16 ? ? -69.76 -163.46 91 15 GLU A 24 ? ? -42.85 109.73 92 15 GLU A 48 ? ? -36.55 -31.87 93 15 CYS A 54 ? ? -46.84 165.63 94 15 PRO A 57 ? ? -69.79 81.41 95 15 SER A 58 ? ? 35.78 42.62 96 16 LEU A 8 ? ? -34.75 100.50 97 16 ALA A 10 ? ? -61.15 94.72 98 16 PRO A 13 ? ? -69.72 -168.57 99 16 PRO A 16 ? ? -69.76 -163.61 100 16 GLU A 24 ? ? -47.82 109.49 101 16 SER A 26 ? ? -131.87 -37.33 102 16 GLU A 48 ? ? -36.02 -38.08 103 16 SER A 58 ? ? -63.05 85.70 104 17 PRO A 13 ? ? -69.76 -163.20 105 17 PRO A 16 ? ? -69.77 -163.24 106 17 GLU A 24 ? ? -48.88 107.08 107 17 GLU A 48 ? ? -36.19 -30.55 108 17 CYS A 54 ? ? -48.22 169.73 109 18 PRO A 13 ? ? -69.78 -163.90 110 18 PRO A 16 ? ? -69.80 -163.93 111 18 GLU A 48 ? ? -36.26 -38.74 112 18 CYS A 54 ? ? -47.84 167.27 113 19 SER A 6 ? ? -53.12 178.41 114 19 GLU A 9 ? ? -171.90 144.58 115 19 ALA A 10 ? ? -46.43 97.68 116 19 PRO A 16 ? ? -69.76 -163.30 117 19 GLU A 24 ? ? -42.23 109.74 118 19 GLU A 48 ? ? -35.90 -34.18 119 19 SER A 59 ? ? -124.17 -59.91 120 20 SER A 2 ? ? -100.79 67.23 121 20 PRO A 13 ? ? -69.73 -165.29 122 20 PRO A 16 ? ? -69.70 -164.25 123 20 GLU A 24 ? ? -38.64 109.22 124 20 CYS A 54 ? ? -47.31 166.94 125 20 PRO A 57 ? ? -69.74 80.24 126 20 SER A 59 ? ? -90.88 42.08 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2DAN _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DAN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy, fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.31mM zf-MYND domain U-15N,13C; 20mM d-Tris-HCL; 100mM Nacl; 1mM d-DTT; 0.02% NaM3; 50uM ZnCl2; 1mM IDA; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2DAN _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMNMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.933 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 HIS N N N N 121 HIS CA C N S 122 HIS C C N N 123 HIS O O N N 124 HIS CB C N N 125 HIS CG C Y N 126 HIS ND1 N Y N 127 HIS CD2 C Y N 128 HIS CE1 C Y N 129 HIS NE2 N Y N 130 HIS OXT O N N 131 HIS H H N N 132 HIS H2 H N N 133 HIS HA H N N 134 HIS HB2 H N N 135 HIS HB3 H N N 136 HIS HD1 H N N 137 HIS HD2 H N N 138 HIS HE1 H N N 139 HIS HE2 H N N 140 HIS HXT H N N 141 LEU N N N N 142 LEU CA C N S 143 LEU C C N N 144 LEU O O N N 145 LEU CB C N N 146 LEU CG C N N 147 LEU CD1 C N N 148 LEU CD2 C N N 149 LEU OXT O N N 150 LEU H H N N 151 LEU H2 H N N 152 LEU HA H N N 153 LEU HB2 H N N 154 LEU HB3 H N N 155 LEU HG H N N 156 LEU HD11 H N N 157 LEU HD12 H N N 158 LEU HD13 H N N 159 LEU HD21 H N N 160 LEU HD22 H N N 161 LEU HD23 H N N 162 LEU HXT H N N 163 LYS N N N N 164 LYS CA C N S 165 LYS C C N N 166 LYS O O N N 167 LYS CB C N N 168 LYS CG C N N 169 LYS CD C N N 170 LYS CE C N N 171 LYS NZ N N N 172 LYS OXT O N N 173 LYS H H N N 174 LYS H2 H N N 175 LYS HA H N N 176 LYS HB2 H N N 177 LYS HB3 H N N 178 LYS HG2 H N N 179 LYS HG3 H N N 180 LYS HD2 H N N 181 LYS HD3 H N N 182 LYS HE2 H N N 183 LYS HE3 H N N 184 LYS HZ1 H N N 185 LYS HZ2 H N N 186 LYS HZ3 H N N 187 LYS HXT H N N 188 PRO N N N N 189 PRO CA C N S 190 PRO C C N N 191 PRO O O N N 192 PRO CB C N N 193 PRO CG C N N 194 PRO CD C N N 195 PRO OXT O N N 196 PRO H H N N 197 PRO HA H N N 198 PRO HB2 H N N 199 PRO HB3 H N N 200 PRO HG2 H N N 201 PRO HG3 H N N 202 PRO HD2 H N N 203 PRO HD3 H N N 204 PRO HXT H N N 205 SER N N N N 206 SER CA C N S 207 SER C C N N 208 SER O O N N 209 SER CB C N N 210 SER OG O N N 211 SER OXT O N N 212 SER H H N N 213 SER H2 H N N 214 SER HA H N N 215 SER HB2 H N N 216 SER HB3 H N N 217 SER HG H N N 218 SER HXT H N N 219 THR N N N N 220 THR CA C N S 221 THR C C N N 222 THR O O N N 223 THR CB C N R 224 THR OG1 O N N 225 THR CG2 C N N 226 THR OXT O N N 227 THR H H N N 228 THR H2 H N N 229 THR HA H N N 230 THR HB H N N 231 THR HG1 H N N 232 THR HG21 H N N 233 THR HG22 H N N 234 THR HG23 H N N 235 THR HXT H N N 236 TRP N N N N 237 TRP CA C N S 238 TRP C C N N 239 TRP O O N N 240 TRP CB C N N 241 TRP CG C Y N 242 TRP CD1 C Y N 243 TRP CD2 C Y N 244 TRP NE1 N Y N 245 TRP CE2 C Y N 246 TRP CE3 C Y N 247 TRP CZ2 C Y N 248 TRP CZ3 C Y N 249 TRP CH2 C Y N 250 TRP OXT O N N 251 TRP H H N N 252 TRP H2 H N N 253 TRP HA H N N 254 TRP HB2 H N N 255 TRP HB3 H N N 256 TRP HD1 H N N 257 TRP HE1 H N N 258 TRP HE3 H N N 259 TRP HZ2 H N N 260 TRP HZ3 H N N 261 TRP HH2 H N N 262 TRP HXT H N N 263 TYR N N N N 264 TYR CA C N S 265 TYR C C N N 266 TYR O O N N 267 TYR CB C N N 268 TYR CG C Y N 269 TYR CD1 C Y N 270 TYR CD2 C Y N 271 TYR CE1 C Y N 272 TYR CE2 C Y N 273 TYR CZ C Y N 274 TYR OH O N N 275 TYR OXT O N N 276 TYR H H N N 277 TYR H2 H N N 278 TYR HA H N N 279 TYR HB2 H N N 280 TYR HB3 H N N 281 TYR HD1 H N N 282 TYR HD2 H N N 283 TYR HE1 H N N 284 TYR HE2 H N N 285 TYR HH H N N 286 TYR HXT H N N 287 VAL N N N N 288 VAL CA C N S 289 VAL C C N N 290 VAL O O N N 291 VAL CB C N N 292 VAL CG1 C N N 293 VAL CG2 C N N 294 VAL OXT O N N 295 VAL H H N N 296 VAL H2 H N N 297 VAL HA H N N 298 VAL HB H N N 299 VAL HG11 H N N 300 VAL HG12 H N N 301 VAL HG13 H N N 302 VAL HG21 H N N 303 VAL HG22 H N N 304 VAL HG23 H N N 305 VAL HXT H N N 306 ZN ZN ZN N N 307 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 HIS N CA sing N N 114 HIS N H sing N N 115 HIS N H2 sing N N 116 HIS CA C sing N N 117 HIS CA CB sing N N 118 HIS CA HA sing N N 119 HIS C O doub N N 120 HIS C OXT sing N N 121 HIS CB CG sing N N 122 HIS CB HB2 sing N N 123 HIS CB HB3 sing N N 124 HIS CG ND1 sing Y N 125 HIS CG CD2 doub Y N 126 HIS ND1 CE1 doub Y N 127 HIS ND1 HD1 sing N N 128 HIS CD2 NE2 sing Y N 129 HIS CD2 HD2 sing N N 130 HIS CE1 NE2 sing Y N 131 HIS CE1 HE1 sing N N 132 HIS NE2 HE2 sing N N 133 HIS OXT HXT sing N N 134 LEU N CA sing N N 135 LEU N H sing N N 136 LEU N H2 sing N N 137 LEU CA C sing N N 138 LEU CA CB sing N N 139 LEU CA HA sing N N 140 LEU C O doub N N 141 LEU C OXT sing N N 142 LEU CB CG sing N N 143 LEU CB HB2 sing N N 144 LEU CB HB3 sing N N 145 LEU CG CD1 sing N N 146 LEU CG CD2 sing N N 147 LEU CG HG sing N N 148 LEU CD1 HD11 sing N N 149 LEU CD1 HD12 sing N N 150 LEU CD1 HD13 sing N N 151 LEU CD2 HD21 sing N N 152 LEU CD2 HD22 sing N N 153 LEU CD2 HD23 sing N N 154 LEU OXT HXT sing N N 155 LYS N CA sing N N 156 LYS N H sing N N 157 LYS N H2 sing N N 158 LYS CA C sing N N 159 LYS CA CB sing N N 160 LYS CA HA sing N N 161 LYS C O doub N N 162 LYS C OXT sing N N 163 LYS CB CG sing N N 164 LYS CB HB2 sing N N 165 LYS CB HB3 sing N N 166 LYS CG CD sing N N 167 LYS CG HG2 sing N N 168 LYS CG HG3 sing N N 169 LYS CD CE sing N N 170 LYS CD HD2 sing N N 171 LYS CD HD3 sing N N 172 LYS CE NZ sing N N 173 LYS CE HE2 sing N N 174 LYS CE HE3 sing N N 175 LYS NZ HZ1 sing N N 176 LYS NZ HZ2 sing N N 177 LYS NZ HZ3 sing N N 178 LYS OXT HXT sing N N 179 PRO N CA sing N N 180 PRO N CD sing N N 181 PRO N H sing N N 182 PRO CA C sing N N 183 PRO CA CB sing N N 184 PRO CA HA sing N N 185 PRO C O doub N N 186 PRO C OXT sing N N 187 PRO CB CG sing N N 188 PRO CB HB2 sing N N 189 PRO CB HB3 sing N N 190 PRO CG CD sing N N 191 PRO CG HG2 sing N N 192 PRO CG HG3 sing N N 193 PRO CD HD2 sing N N 194 PRO CD HD3 sing N N 195 PRO OXT HXT sing N N 196 SER N CA sing N N 197 SER N H sing N N 198 SER N H2 sing N N 199 SER CA C sing N N 200 SER CA CB sing N N 201 SER CA HA sing N N 202 SER C O doub N N 203 SER C OXT sing N N 204 SER CB OG sing N N 205 SER CB HB2 sing N N 206 SER CB HB3 sing N N 207 SER OG HG sing N N 208 SER OXT HXT sing N N 209 THR N CA sing N N 210 THR N H sing N N 211 THR N H2 sing N N 212 THR CA C sing N N 213 THR CA CB sing N N 214 THR CA HA sing N N 215 THR C O doub N N 216 THR C OXT sing N N 217 THR CB OG1 sing N N 218 THR CB CG2 sing N N 219 THR CB HB sing N N 220 THR OG1 HG1 sing N N 221 THR CG2 HG21 sing N N 222 THR CG2 HG22 sing N N 223 THR CG2 HG23 sing N N 224 THR OXT HXT sing N N 225 TRP N CA sing N N 226 TRP N H sing N N 227 TRP N H2 sing N N 228 TRP CA C sing N N 229 TRP CA CB sing N N 230 TRP CA HA sing N N 231 TRP C O doub N N 232 TRP C OXT sing N N 233 TRP CB CG sing N N 234 TRP CB HB2 sing N N 235 TRP CB HB3 sing N N 236 TRP CG CD1 doub Y N 237 TRP CG CD2 sing Y N 238 TRP CD1 NE1 sing Y N 239 TRP CD1 HD1 sing N N 240 TRP CD2 CE2 doub Y N 241 TRP CD2 CE3 sing Y N 242 TRP NE1 CE2 sing Y N 243 TRP NE1 HE1 sing N N 244 TRP CE2 CZ2 sing Y N 245 TRP CE3 CZ3 doub Y N 246 TRP CE3 HE3 sing N N 247 TRP CZ2 CH2 doub Y N 248 TRP CZ2 HZ2 sing N N 249 TRP CZ3 CH2 sing Y N 250 TRP CZ3 HZ3 sing N N 251 TRP CH2 HH2 sing N N 252 TRP OXT HXT sing N N 253 TYR N CA sing N N 254 TYR N H sing N N 255 TYR N H2 sing N N 256 TYR CA C sing N N 257 TYR CA CB sing N N 258 TYR CA HA sing N N 259 TYR C O doub N N 260 TYR C OXT sing N N 261 TYR CB CG sing N N 262 TYR CB HB2 sing N N 263 TYR CB HB3 sing N N 264 TYR CG CD1 doub Y N 265 TYR CG CD2 sing Y N 266 TYR CD1 CE1 sing Y N 267 TYR CD1 HD1 sing N N 268 TYR CD2 CE2 doub Y N 269 TYR CD2 HD2 sing N N 270 TYR CE1 CZ doub Y N 271 TYR CE1 HE1 sing N N 272 TYR CE2 CZ sing Y N 273 TYR CE2 HE2 sing N N 274 TYR CZ OH sing N N 275 TYR OH HH sing N N 276 TYR OXT HXT sing N N 277 VAL N CA sing N N 278 VAL N H sing N N 279 VAL N H2 sing N N 280 VAL CA C sing N N 281 VAL CA CB sing N N 282 VAL CA HA sing N N 283 VAL C O doub N N 284 VAL C OXT sing N N 285 VAL CB CG1 sing N N 286 VAL CB CG2 sing N N 287 VAL CB HB sing N N 288 VAL CG1 HG11 sing N N 289 VAL CG1 HG12 sing N N 290 VAL CG1 HG13 sing N N 291 VAL CG2 HG21 sing N N 292 VAL CG2 HG22 sing N N 293 VAL CG2 HG23 sing N N 294 VAL OXT HXT sing N N 295 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2DAN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_