data_2DB2 # _entry.id 2DB2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DB2 pdb_00002db2 10.2210/pdb2db2/pdb RCSB RCSB025203 ? ? WWPDB D_1000025203 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DB2 _pdbx_database_status.recvd_initial_deposition_date 2005-12-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002000869.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Abe, C.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Terada, T.' 5 'Shirouzu, M.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the double-stranded RNA binding domain in KIAA0890 protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Abe, C.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Terada, T.' 5 ? primary 'Shirouzu, M.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'KIAA0890 protein' _entity.formula_weight 12785.647 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Double-stranded RNA binding motif' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLHIKWPKSVEVEGYGSKKIDAERQAA AAACQLFKGWGLLGPRNELFDAAKYRVLADRFGSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLHIKWPKSVEVEGYGSKKIDAERQAA AAACQLFKGWGLLGPRNELFDAAKYRVLADRFGSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002000869.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ALA n 1 9 SER n 1 10 ARG n 1 11 ASP n 1 12 LEU n 1 13 LEU n 1 14 LYS n 1 15 GLU n 1 16 PHE n 1 17 PRO n 1 18 GLN n 1 19 PRO n 1 20 LYS n 1 21 ASN n 1 22 LEU n 1 23 LEU n 1 24 ASN n 1 25 SER n 1 26 VAL n 1 27 ILE n 1 28 GLY n 1 29 ARG n 1 30 ALA n 1 31 LEU n 1 32 GLY n 1 33 ILE n 1 34 SER n 1 35 HIS n 1 36 ALA n 1 37 LYS n 1 38 ASP n 1 39 LYS n 1 40 LEU n 1 41 VAL n 1 42 TYR n 1 43 VAL n 1 44 HIS n 1 45 THR n 1 46 ASN n 1 47 GLY n 1 48 PRO n 1 49 LYS n 1 50 LYS n 1 51 LYS n 1 52 LYS n 1 53 VAL n 1 54 THR n 1 55 LEU n 1 56 HIS n 1 57 ILE n 1 58 LYS n 1 59 TRP n 1 60 PRO n 1 61 LYS n 1 62 SER n 1 63 VAL n 1 64 GLU n 1 65 VAL n 1 66 GLU n 1 67 GLY n 1 68 TYR n 1 69 GLY n 1 70 SER n 1 71 LYS n 1 72 LYS n 1 73 ILE n 1 74 ASP n 1 75 ALA n 1 76 GLU n 1 77 ARG n 1 78 GLN n 1 79 ALA n 1 80 ALA n 1 81 ALA n 1 82 ALA n 1 83 ALA n 1 84 CYS n 1 85 GLN n 1 86 LEU n 1 87 PHE n 1 88 LYS n 1 89 GLY n 1 90 TRP n 1 91 GLY n 1 92 LEU n 1 93 LEU n 1 94 GLY n 1 95 PRO n 1 96 ARG n 1 97 ASN n 1 98 GLU n 1 99 LEU n 1 100 PHE n 1 101 ASP n 1 102 ALA n 1 103 ALA n 1 104 LYS n 1 105 TYR n 1 106 ARG n 1 107 VAL n 1 108 LEU n 1 109 ALA n 1 110 ASP n 1 111 ARG n 1 112 PHE n 1 113 GLY n 1 114 SER n 1 115 GLY n 1 116 PRO n 1 117 SER n 1 118 SER n 1 119 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene KIAA0890 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050725-08 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 51 51 GLY GLY A . n A 1 2 SER 2 52 52 SER SER A . n A 1 3 SER 3 53 53 SER SER A . n A 1 4 GLY 4 54 54 GLY GLY A . n A 1 5 SER 5 55 55 SER SER A . n A 1 6 SER 6 56 56 SER SER A . n A 1 7 GLY 7 57 57 GLY GLY A . n A 1 8 ALA 8 58 58 ALA ALA A . n A 1 9 SER 9 59 59 SER SER A . n A 1 10 ARG 10 60 60 ARG ARG A . n A 1 11 ASP 11 61 61 ASP ASP A . n A 1 12 LEU 12 62 62 LEU LEU A . n A 1 13 LEU 13 63 63 LEU LEU A . n A 1 14 LYS 14 64 64 LYS LYS A . n A 1 15 GLU 15 65 65 GLU GLU A . n A 1 16 PHE 16 66 66 PHE PHE A . n A 1 17 PRO 17 67 67 PRO PRO A . n A 1 18 GLN 18 68 68 GLN GLN A . n A 1 19 PRO 19 69 69 PRO PRO A . n A 1 20 LYS 20 70 70 LYS LYS A . n A 1 21 ASN 21 71 71 ASN ASN A . n A 1 22 LEU 22 72 72 LEU LEU A . n A 1 23 LEU 23 73 73 LEU LEU A . n A 1 24 ASN 24 74 74 ASN ASN A . n A 1 25 SER 25 75 75 SER SER A . n A 1 26 VAL 26 76 76 VAL VAL A . n A 1 27 ILE 27 77 77 ILE ILE A . n A 1 28 GLY 28 78 78 GLY GLY A . n A 1 29 ARG 29 79 79 ARG ARG A . n A 1 30 ALA 30 80 80 ALA ALA A . n A 1 31 LEU 31 81 81 LEU LEU A . n A 1 32 GLY 32 82 82 GLY GLY A . n A 1 33 ILE 33 83 83 ILE ILE A . n A 1 34 SER 34 84 84 SER SER A . n A 1 35 HIS 35 85 85 HIS HIS A . n A 1 36 ALA 36 86 86 ALA ALA A . n A 1 37 LYS 37 87 87 LYS LYS A . n A 1 38 ASP 38 88 88 ASP ASP A . n A 1 39 LYS 39 89 89 LYS LYS A . n A 1 40 LEU 40 90 90 LEU LEU A . n A 1 41 VAL 41 91 91 VAL VAL A . n A 1 42 TYR 42 92 92 TYR TYR A . n A 1 43 VAL 43 93 93 VAL VAL A . n A 1 44 HIS 44 94 94 HIS HIS A . n A 1 45 THR 45 95 95 THR THR A . n A 1 46 ASN 46 96 96 ASN ASN A . n A 1 47 GLY 47 97 97 GLY GLY A . n A 1 48 PRO 48 98 98 PRO PRO A . n A 1 49 LYS 49 99 99 LYS LYS A . n A 1 50 LYS 50 100 100 LYS LYS A . n A 1 51 LYS 51 101 101 LYS LYS A . n A 1 52 LYS 52 102 102 LYS LYS A . n A 1 53 VAL 53 103 103 VAL VAL A . n A 1 54 THR 54 104 104 THR THR A . n A 1 55 LEU 55 105 105 LEU LEU A . n A 1 56 HIS 56 106 106 HIS HIS A . n A 1 57 ILE 57 107 107 ILE ILE A . n A 1 58 LYS 58 108 108 LYS LYS A . n A 1 59 TRP 59 109 109 TRP TRP A . n A 1 60 PRO 60 110 110 PRO PRO A . n A 1 61 LYS 61 111 111 LYS LYS A . n A 1 62 SER 62 112 112 SER SER A . n A 1 63 VAL 63 113 113 VAL VAL A . n A 1 64 GLU 64 114 114 GLU GLU A . n A 1 65 VAL 65 115 115 VAL VAL A . n A 1 66 GLU 66 116 116 GLU GLU A . n A 1 67 GLY 67 117 117 GLY GLY A . n A 1 68 TYR 68 118 118 TYR TYR A . n A 1 69 GLY 69 119 119 GLY GLY A . n A 1 70 SER 70 120 120 SER SER A . n A 1 71 LYS 71 121 121 LYS LYS A . n A 1 72 LYS 72 122 122 LYS LYS A . n A 1 73 ILE 73 123 123 ILE ILE A . n A 1 74 ASP 74 124 124 ASP ASP A . n A 1 75 ALA 75 125 125 ALA ALA A . n A 1 76 GLU 76 126 126 GLU GLU A . n A 1 77 ARG 77 127 127 ARG ARG A . n A 1 78 GLN 78 128 128 GLN GLN A . n A 1 79 ALA 79 129 129 ALA ALA A . n A 1 80 ALA 80 130 130 ALA ALA A . n A 1 81 ALA 81 131 131 ALA ALA A . n A 1 82 ALA 82 132 132 ALA ALA A . n A 1 83 ALA 83 133 133 ALA ALA A . n A 1 84 CYS 84 134 134 CYS CYS A . n A 1 85 GLN 85 135 135 GLN GLN A . n A 1 86 LEU 86 136 136 LEU LEU A . n A 1 87 PHE 87 137 137 PHE PHE A . n A 1 88 LYS 88 138 138 LYS LYS A . n A 1 89 GLY 89 139 139 GLY GLY A . n A 1 90 TRP 90 140 140 TRP TRP A . n A 1 91 GLY 91 141 141 GLY GLY A . n A 1 92 LEU 92 142 142 LEU LEU A . n A 1 93 LEU 93 143 143 LEU LEU A . n A 1 94 GLY 94 144 144 GLY GLY A . n A 1 95 PRO 95 145 145 PRO PRO A . n A 1 96 ARG 96 146 146 ARG ARG A . n A 1 97 ASN 97 147 147 ASN ASN A . n A 1 98 GLU 98 148 148 GLU GLU A . n A 1 99 LEU 99 149 149 LEU LEU A . n A 1 100 PHE 100 150 150 PHE PHE A . n A 1 101 ASP 101 151 151 ASP ASP A . n A 1 102 ALA 102 152 152 ALA ALA A . n A 1 103 ALA 103 153 153 ALA ALA A . n A 1 104 LYS 104 154 154 LYS LYS A . n A 1 105 TYR 105 155 155 TYR TYR A . n A 1 106 ARG 106 156 156 ARG ARG A . n A 1 107 VAL 107 157 157 VAL VAL A . n A 1 108 LEU 108 158 158 LEU LEU A . n A 1 109 ALA 109 159 159 ALA ALA A . n A 1 110 ASP 110 160 160 ASP ASP A . n A 1 111 ARG 111 161 161 ARG ARG A . n A 1 112 PHE 112 162 162 PHE PHE A . n A 1 113 GLY 113 163 163 GLY GLY A . n A 1 114 SER 114 164 164 SER SER A . n A 1 115 GLY 115 165 165 GLY GLY A . n A 1 116 PRO 116 166 166 PRO PRO A . n A 1 117 SER 117 167 167 SER SER A . n A 1 118 SER 118 168 168 SER SER A . n A 1 119 GLY 119 169 169 GLY GLY A . n # _exptl.entry_id 2DB2 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2DB2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2DB2 _struct.title 'Solution structure of the double-stranded RNA binding domain in KIAA0890 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DB2 _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text ;DSRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9NUQ0_HUMAN _struct_ref.pdbx_db_accession Q9NUQ0 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 70 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DB2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 113 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NUQ0 _struct_ref_seq.db_align_beg 70 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 176 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 58 _struct_ref_seq.pdbx_auth_seq_align_end 163 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DB2 GLY A 1 ? UNP Q9NUQ0 ? ? 'cloning artifact' 51 1 1 2DB2 SER A 2 ? UNP Q9NUQ0 ? ? 'cloning artifact' 52 2 1 2DB2 SER A 3 ? UNP Q9NUQ0 ? ? 'cloning artifact' 53 3 1 2DB2 GLY A 4 ? UNP Q9NUQ0 ? ? 'cloning artifact' 54 4 1 2DB2 SER A 5 ? UNP Q9NUQ0 ? ? 'cloning artifact' 55 5 1 2DB2 SER A 6 ? UNP Q9NUQ0 ? ? 'cloning artifact' 56 6 1 2DB2 GLY A 7 ? UNP Q9NUQ0 ? ? 'cloning artifact' 57 7 1 2DB2 SER A 114 ? UNP Q9NUQ0 ? ? 'cloning artifact' 164 8 1 2DB2 GLY A 115 ? UNP Q9NUQ0 ? ? 'cloning artifact' 165 9 1 2DB2 PRO A 116 ? UNP Q9NUQ0 ? ? 'cloning artifact' 166 10 1 2DB2 SER A 117 ? UNP Q9NUQ0 ? ? 'cloning artifact' 167 11 1 2DB2 SER A 118 ? UNP Q9NUQ0 ? ? 'cloning artifact' 168 12 1 2DB2 GLY A 119 ? UNP Q9NUQ0 ? ? 'cloning artifact' 169 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 18 ? LEU A 31 ? GLN A 68 LEU A 81 1 ? 14 HELX_P HELX_P2 2 GLY A 32 ? LYS A 39 ? GLY A 82 LYS A 89 1 ? 8 HELX_P HELX_P3 3 LYS A 71 ? GLY A 91 ? LYS A 121 GLY A 141 1 ? 21 HELX_P HELX_P4 4 ASP A 101 ? ARG A 111 ? ASP A 151 ARG A 161 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 1 -0.06 2 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 2 -0.05 3 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 3 -0.08 4 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 4 0.00 5 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 5 -0.13 6 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 6 -0.05 7 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 7 -0.08 8 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 8 0.01 9 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 9 -0.05 10 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 10 0.00 11 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 11 -0.05 12 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 12 0.00 13 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 13 0.06 14 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 14 -0.04 15 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 15 -0.03 16 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 16 -0.09 17 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 17 -0.07 18 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 18 -0.10 19 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 19 -0.06 20 TRP 59 A . ? TRP 109 A PRO 60 A ? PRO 110 A 20 -0.08 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 40 ? HIS A 44 ? LEU A 90 HIS A 94 A 2 LYS A 51 ? ILE A 57 ? LYS A 101 ILE A 107 A 3 VAL A 63 ? GLY A 69 ? VAL A 113 GLY A 119 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 43 ? N VAL A 93 O THR A 54 ? O THR A 104 A 2 3 N ILE A 57 ? N ILE A 107 O VAL A 63 ? O VAL A 113 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 68 ? ? -114.14 74.64 2 1 VAL A 76 ? ? -57.62 -73.62 3 1 LEU A 81 ? ? -102.61 -66.54 4 1 ALA A 86 ? ? -37.44 -37.21 5 1 LEU A 143 ? ? -104.95 -63.31 6 1 LEU A 149 ? ? -48.64 175.70 7 2 VAL A 76 ? ? -53.14 -71.52 8 2 LEU A 81 ? ? -99.09 -68.35 9 2 ILE A 83 ? ? -39.05 -32.48 10 2 LEU A 149 ? ? -44.75 168.21 11 2 ARG A 161 ? ? -38.63 -28.28 12 2 SER A 164 ? ? -86.98 38.91 13 3 SER A 52 ? ? -87.65 48.58 14 3 VAL A 76 ? ? -38.97 -72.08 15 3 LEU A 81 ? ? -97.75 -67.17 16 3 ALA A 86 ? ? -37.61 -31.27 17 3 LYS A 89 ? ? -39.12 -34.46 18 3 PRO A 166 ? ? -69.72 94.49 19 4 VAL A 76 ? ? -56.55 -74.70 20 4 LEU A 81 ? ? -95.75 -66.03 21 4 ILE A 83 ? ? -38.59 -37.62 22 4 ALA A 86 ? ? -39.29 -39.13 23 4 LEU A 143 ? ? -106.91 -61.86 24 4 LEU A 149 ? ? -46.64 166.83 25 4 SER A 164 ? ? -38.40 155.80 26 4 PRO A 166 ? ? -69.78 -178.08 27 5 SER A 53 ? ? 34.90 42.14 28 5 VAL A 76 ? ? -51.93 -74.57 29 5 LEU A 81 ? ? -96.93 -65.35 30 5 ILE A 83 ? ? -37.13 -38.44 31 5 LEU A 143 ? ? -126.90 -69.30 32 5 ARG A 146 ? ? -99.66 31.36 33 6 SER A 52 ? ? -123.19 -53.94 34 6 VAL A 76 ? ? -56.65 -72.40 35 6 LEU A 81 ? ? -95.52 -61.60 36 6 PRO A 98 ? ? -69.82 -176.93 37 6 LEU A 143 ? ? -108.05 -65.63 38 6 SER A 168 ? ? 35.16 49.54 39 7 SER A 59 ? ? -89.10 40.03 40 7 VAL A 76 ? ? -61.12 -72.11 41 7 LEU A 81 ? ? -104.35 -69.85 42 7 ARG A 146 ? ? -97.28 34.79 43 7 ASN A 147 ? ? 39.96 53.77 44 8 VAL A 76 ? ? -50.22 -71.19 45 8 LEU A 81 ? ? -105.58 -66.04 46 8 ILE A 83 ? ? -33.83 -34.43 47 8 ALA A 86 ? ? -36.30 -29.74 48 8 LYS A 89 ? ? -39.59 -25.58 49 8 PRO A 98 ? ? -69.73 -179.03 50 9 LEU A 81 ? ? -95.41 -65.38 51 9 ILE A 83 ? ? -39.84 -38.76 52 9 LEU A 143 ? ? -104.01 -63.42 53 9 LEU A 149 ? ? -44.02 159.18 54 9 SER A 164 ? ? -52.80 173.62 55 9 PRO A 166 ? ? -69.74 87.07 56 10 SER A 53 ? ? -169.09 111.47 57 10 ASP A 61 ? ? -38.48 120.65 58 10 VAL A 76 ? ? -66.06 -75.01 59 10 LEU A 81 ? ? -97.33 -69.68 60 10 ILE A 83 ? ? -35.59 -36.52 61 10 LEU A 149 ? ? -57.57 179.61 62 10 ARG A 161 ? ? -35.22 -36.21 63 10 SER A 164 ? ? -36.52 147.65 64 11 SER A 55 ? ? -160.56 106.14 65 11 GLN A 68 ? ? -119.68 75.32 66 11 VAL A 76 ? ? -46.39 -72.04 67 11 LEU A 81 ? ? -100.74 -61.45 68 11 ILE A 83 ? ? -39.95 -36.68 69 11 ALA A 86 ? ? -35.56 -33.30 70 11 LYS A 89 ? ? -36.39 -38.51 71 11 PRO A 98 ? ? -69.77 -173.36 72 11 ALA A 125 ? ? -66.51 -72.06 73 12 SER A 56 ? ? 37.92 42.84 74 12 ASP A 61 ? ? -39.38 157.38 75 12 VAL A 76 ? ? -51.37 -74.86 76 12 LEU A 81 ? ? -107.55 -69.61 77 12 ILE A 83 ? ? -39.84 -38.28 78 12 SER A 164 ? ? -93.70 -62.60 79 13 SER A 55 ? ? -84.06 43.21 80 13 VAL A 76 ? ? -48.38 -73.79 81 13 LEU A 81 ? ? -101.98 -69.37 82 13 ILE A 83 ? ? -38.70 -37.31 83 13 ALA A 86 ? ? -39.76 -28.59 84 13 PRO A 98 ? ? -69.76 -166.61 85 13 ASN A 147 ? ? 39.93 50.98 86 13 LEU A 149 ? ? -44.60 165.88 87 14 VAL A 76 ? ? -48.25 -71.53 88 14 LEU A 81 ? ? -100.69 -65.54 89 14 LEU A 143 ? ? -106.20 -64.19 90 14 ARG A 146 ? ? -105.76 41.34 91 14 LEU A 149 ? ? -43.67 164.40 92 15 SER A 52 ? ? -133.71 -48.22 93 15 LEU A 62 ? ? -39.12 -28.17 94 15 LEU A 81 ? ? -98.80 -62.67 95 15 ILE A 83 ? ? -39.49 -37.24 96 15 ALA A 86 ? ? -38.85 -32.58 97 15 LYS A 89 ? ? -34.16 -37.51 98 15 LEU A 149 ? ? -57.44 -177.27 99 15 SER A 168 ? ? -36.90 125.30 100 16 ARG A 60 ? ? -65.78 88.61 101 16 VAL A 76 ? ? -48.70 -71.42 102 16 LEU A 81 ? ? -93.61 -67.03 103 16 ILE A 83 ? ? -36.49 -37.32 104 16 LEU A 149 ? ? -48.19 159.17 105 17 SER A 52 ? ? -101.90 42.17 106 17 SER A 53 ? ? -37.58 140.16 107 17 SER A 59 ? ? -39.93 149.36 108 17 GLN A 68 ? ? -116.57 77.53 109 17 VAL A 76 ? ? -50.99 -71.34 110 17 LEU A 81 ? ? -98.63 -68.41 111 17 ALA A 86 ? ? -39.37 -35.86 112 17 ARG A 146 ? ? -92.10 30.98 113 17 ASN A 147 ? ? 40.00 52.38 114 17 LEU A 149 ? ? -44.81 170.32 115 18 ASP A 61 ? ? -35.13 110.38 116 18 GLN A 68 ? ? -117.36 77.16 117 18 VAL A 76 ? ? -53.03 -71.03 118 18 LEU A 81 ? ? -97.79 -66.00 119 18 ILE A 83 ? ? -37.81 -36.43 120 18 ALA A 86 ? ? -39.40 -35.97 121 18 LEU A 149 ? ? -38.72 158.62 122 18 PRO A 166 ? ? -69.73 98.97 123 18 SER A 167 ? ? -34.47 120.22 124 19 SER A 56 ? ? -48.63 109.55 125 19 ALA A 58 ? ? -52.84 95.35 126 19 SER A 59 ? ? -42.81 159.89 127 19 ASP A 61 ? ? -38.65 118.85 128 19 GLN A 68 ? ? -116.47 74.70 129 19 VAL A 76 ? ? -54.30 -74.77 130 19 LEU A 81 ? ? -100.09 -62.75 131 19 PRO A 98 ? ? -69.76 97.27 132 19 LEU A 149 ? ? -46.68 173.24 133 19 ARG A 161 ? ? -37.59 -37.30 134 19 SER A 168 ? ? -98.82 42.23 135 20 SER A 59 ? ? -50.66 108.69 136 20 VAL A 76 ? ? -54.10 -74.99 137 20 LEU A 81 ? ? -97.06 -68.22 138 20 LYS A 99 ? ? -36.66 -35.13 139 20 LEU A 143 ? ? -108.83 -64.03 140 20 LEU A 149 ? ? -49.90 177.82 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2DB2 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DB2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20mM d-Tris-HCl (pH 7.0), 100mM NaCl, 1mM d-DTT, 0.02% NaN; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2DB2 _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 Delaglio,F 2 'data analysis' NMRView 5.0.4 Johnson,B.A 3 'data analysis' KUJIRA 0.93191 Kobayashi,N 4 'structure solution' CYANA 2.0 Guntert,P 5 refinement CYANA 2.0 Guntert,P 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TRP N N N N 298 TRP CA C N S 299 TRP C C N N 300 TRP O O N N 301 TRP CB C N N 302 TRP CG C Y N 303 TRP CD1 C Y N 304 TRP CD2 C Y N 305 TRP NE1 N Y N 306 TRP CE2 C Y N 307 TRP CE3 C Y N 308 TRP CZ2 C Y N 309 TRP CZ3 C Y N 310 TRP CH2 C Y N 311 TRP OXT O N N 312 TRP H H N N 313 TRP H2 H N N 314 TRP HA H N N 315 TRP HB2 H N N 316 TRP HB3 H N N 317 TRP HD1 H N N 318 TRP HE1 H N N 319 TRP HE3 H N N 320 TRP HZ2 H N N 321 TRP HZ3 H N N 322 TRP HH2 H N N 323 TRP HXT H N N 324 TYR N N N N 325 TYR CA C N S 326 TYR C C N N 327 TYR O O N N 328 TYR CB C N N 329 TYR CG C Y N 330 TYR CD1 C Y N 331 TYR CD2 C Y N 332 TYR CE1 C Y N 333 TYR CE2 C Y N 334 TYR CZ C Y N 335 TYR OH O N N 336 TYR OXT O N N 337 TYR H H N N 338 TYR H2 H N N 339 TYR HA H N N 340 TYR HB2 H N N 341 TYR HB3 H N N 342 TYR HD1 H N N 343 TYR HD2 H N N 344 TYR HE1 H N N 345 TYR HE2 H N N 346 TYR HH H N N 347 TYR HXT H N N 348 VAL N N N N 349 VAL CA C N S 350 VAL C C N N 351 VAL O O N N 352 VAL CB C N N 353 VAL CG1 C N N 354 VAL CG2 C N N 355 VAL OXT O N N 356 VAL H H N N 357 VAL H2 H N N 358 VAL HA H N N 359 VAL HB H N N 360 VAL HG11 H N N 361 VAL HG12 H N N 362 VAL HG13 H N N 363 VAL HG21 H N N 364 VAL HG22 H N N 365 VAL HG23 H N N 366 VAL HXT H N N 367 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TRP N CA sing N N 285 TRP N H sing N N 286 TRP N H2 sing N N 287 TRP CA C sing N N 288 TRP CA CB sing N N 289 TRP CA HA sing N N 290 TRP C O doub N N 291 TRP C OXT sing N N 292 TRP CB CG sing N N 293 TRP CB HB2 sing N N 294 TRP CB HB3 sing N N 295 TRP CG CD1 doub Y N 296 TRP CG CD2 sing Y N 297 TRP CD1 NE1 sing Y N 298 TRP CD1 HD1 sing N N 299 TRP CD2 CE2 doub Y N 300 TRP CD2 CE3 sing Y N 301 TRP NE1 CE2 sing Y N 302 TRP NE1 HE1 sing N N 303 TRP CE2 CZ2 sing Y N 304 TRP CE3 CZ3 doub Y N 305 TRP CE3 HE3 sing N N 306 TRP CZ2 CH2 doub Y N 307 TRP CZ2 HZ2 sing N N 308 TRP CZ3 CH2 sing Y N 309 TRP CZ3 HZ3 sing N N 310 TRP CH2 HH2 sing N N 311 TRP OXT HXT sing N N 312 TYR N CA sing N N 313 TYR N H sing N N 314 TYR N H2 sing N N 315 TYR CA C sing N N 316 TYR CA CB sing N N 317 TYR CA HA sing N N 318 TYR C O doub N N 319 TYR C OXT sing N N 320 TYR CB CG sing N N 321 TYR CB HB2 sing N N 322 TYR CB HB3 sing N N 323 TYR CG CD1 doub Y N 324 TYR CG CD2 sing Y N 325 TYR CD1 CE1 sing Y N 326 TYR CD1 HD1 sing N N 327 TYR CD2 CE2 doub Y N 328 TYR CD2 HD2 sing N N 329 TYR CE1 CZ doub Y N 330 TYR CE1 HE1 sing N N 331 TYR CE2 CZ sing Y N 332 TYR CE2 HE2 sing N N 333 TYR CZ OH sing N N 334 TYR OH HH sing N N 335 TYR OXT HXT sing N N 336 VAL N CA sing N N 337 VAL N H sing N N 338 VAL N H2 sing N N 339 VAL CA C sing N N 340 VAL CA CB sing N N 341 VAL CA HA sing N N 342 VAL C O doub N N 343 VAL C OXT sing N N 344 VAL CB CG1 sing N N 345 VAL CB CG2 sing N N 346 VAL CB HB sing N N 347 VAL CG1 HG11 sing N N 348 VAL CG1 HG12 sing N N 349 VAL CG1 HG13 sing N N 350 VAL CG2 HG21 sing N N 351 VAL CG2 HG22 sing N N 352 VAL CG2 HG23 sing N N 353 VAL OXT HXT sing N N 354 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2DB2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_