data_2DGO # _entry.id 2DGO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DGO pdb_00002dgo 10.2210/pdb2dgo/pdb RCSB RCSB025396 ? ? WWPDB D_1000025396 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-09-15 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DGO _pdbx_database_status.recvd_initial_deposition_date 2006-03-15 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt008000372.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Abe, C.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Terada, T.' 5 'Shirouzu, M.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the RNA binding domain in cytotoxic granule-associated RNA binding protein 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Abe, C.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Terada, T.' 5 ? primary 'Shirouzu, M.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cytotoxic granule-associated RNA binding protein 1' _entity.formula_weight 12432.717 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RNA recognition motif' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQ WLGGRQIRTNWATRKPPAPKSTYESNTKQSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQ WLGGRQIRTNWATRKPPAPKSTYESNTKQSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt008000372.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLN n 1 9 LYS n 1 10 LYS n 1 11 ASP n 1 12 THR n 1 13 SER n 1 14 ASN n 1 15 HIS n 1 16 PHE n 1 17 HIS n 1 18 VAL n 1 19 PHE n 1 20 VAL n 1 21 GLY n 1 22 ASP n 1 23 LEU n 1 24 SER n 1 25 PRO n 1 26 GLU n 1 27 ILE n 1 28 THR n 1 29 THR n 1 30 GLU n 1 31 ASP n 1 32 ILE n 1 33 LYS n 1 34 ALA n 1 35 ALA n 1 36 PHE n 1 37 ALA n 1 38 PRO n 1 39 PHE n 1 40 GLY n 1 41 ARG n 1 42 ILE n 1 43 SER n 1 44 ASP n 1 45 ALA n 1 46 ARG n 1 47 VAL n 1 48 VAL n 1 49 LYS n 1 50 ASP n 1 51 MET n 1 52 ALA n 1 53 THR n 1 54 GLY n 1 55 LYS n 1 56 SER n 1 57 LYS n 1 58 GLY n 1 59 TYR n 1 60 GLY n 1 61 PHE n 1 62 VAL n 1 63 SER n 1 64 PHE n 1 65 PHE n 1 66 ASN n 1 67 LYS n 1 68 TRP n 1 69 ASP n 1 70 ALA n 1 71 GLU n 1 72 ASN n 1 73 ALA n 1 74 ILE n 1 75 GLN n 1 76 GLN n 1 77 MET n 1 78 GLY n 1 79 GLY n 1 80 GLN n 1 81 TRP n 1 82 LEU n 1 83 GLY n 1 84 GLY n 1 85 ARG n 1 86 GLN n 1 87 ILE n 1 88 ARG n 1 89 THR n 1 90 ASN n 1 91 TRP n 1 92 ALA n 1 93 THR n 1 94 ARG n 1 95 LYS n 1 96 PRO n 1 97 PRO n 1 98 ALA n 1 99 PRO n 1 100 LYS n 1 101 SER n 1 102 THR n 1 103 TYR n 1 104 GLU n 1 105 SER n 1 106 ASN n 1 107 THR n 1 108 LYS n 1 109 GLN n 1 110 SER n 1 111 GLY n 1 112 PRO n 1 113 SER n 1 114 SER n 1 115 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene Tia1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050425-20 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 63 63 GLY GLY A . n A 1 2 SER 2 64 64 SER SER A . n A 1 3 SER 3 65 65 SER SER A . n A 1 4 GLY 4 66 66 GLY GLY A . n A 1 5 SER 5 67 67 SER SER A . n A 1 6 SER 6 68 68 SER SER A . n A 1 7 GLY 7 69 69 GLY GLY A . n A 1 8 GLN 8 70 70 GLN GLN A . n A 1 9 LYS 9 71 71 LYS LYS A . n A 1 10 LYS 10 72 72 LYS LYS A . n A 1 11 ASP 11 73 73 ASP ASP A . n A 1 12 THR 12 74 74 THR THR A . n A 1 13 SER 13 75 75 SER SER A . n A 1 14 ASN 14 76 76 ASN ASN A . n A 1 15 HIS 15 77 77 HIS HIS A . n A 1 16 PHE 16 78 78 PHE PHE A . n A 1 17 HIS 17 79 79 HIS HIS A . n A 1 18 VAL 18 80 80 VAL VAL A . n A 1 19 PHE 19 81 81 PHE PHE A . n A 1 20 VAL 20 82 82 VAL VAL A . n A 1 21 GLY 21 83 83 GLY GLY A . n A 1 22 ASP 22 84 84 ASP ASP A . n A 1 23 LEU 23 85 85 LEU LEU A . n A 1 24 SER 24 86 86 SER SER A . n A 1 25 PRO 25 87 87 PRO PRO A . n A 1 26 GLU 26 88 88 GLU GLU A . n A 1 27 ILE 27 89 89 ILE ILE A . n A 1 28 THR 28 90 90 THR THR A . n A 1 29 THR 29 91 91 THR THR A . n A 1 30 GLU 30 92 92 GLU GLU A . n A 1 31 ASP 31 93 93 ASP ASP A . n A 1 32 ILE 32 94 94 ILE ILE A . n A 1 33 LYS 33 95 95 LYS LYS A . n A 1 34 ALA 34 96 96 ALA ALA A . n A 1 35 ALA 35 97 97 ALA ALA A . n A 1 36 PHE 36 98 98 PHE PHE A . n A 1 37 ALA 37 99 99 ALA ALA A . n A 1 38 PRO 38 100 100 PRO PRO A . n A 1 39 PHE 39 101 101 PHE PHE A . n A 1 40 GLY 40 102 102 GLY GLY A . n A 1 41 ARG 41 103 103 ARG ARG A . n A 1 42 ILE 42 104 104 ILE ILE A . n A 1 43 SER 43 105 105 SER SER A . n A 1 44 ASP 44 106 106 ASP ASP A . n A 1 45 ALA 45 107 107 ALA ALA A . n A 1 46 ARG 46 108 108 ARG ARG A . n A 1 47 VAL 47 109 109 VAL VAL A . n A 1 48 VAL 48 110 110 VAL VAL A . n A 1 49 LYS 49 111 111 LYS LYS A . n A 1 50 ASP 50 112 112 ASP ASP A . n A 1 51 MET 51 113 113 MET MET A . n A 1 52 ALA 52 114 114 ALA ALA A . n A 1 53 THR 53 115 115 THR THR A . n A 1 54 GLY 54 116 116 GLY GLY A . n A 1 55 LYS 55 117 117 LYS LYS A . n A 1 56 SER 56 118 118 SER SER A . n A 1 57 LYS 57 119 119 LYS LYS A . n A 1 58 GLY 58 120 120 GLY GLY A . n A 1 59 TYR 59 121 121 TYR TYR A . n A 1 60 GLY 60 122 122 GLY GLY A . n A 1 61 PHE 61 123 123 PHE PHE A . n A 1 62 VAL 62 124 124 VAL VAL A . n A 1 63 SER 63 125 125 SER SER A . n A 1 64 PHE 64 126 126 PHE PHE A . n A 1 65 PHE 65 127 127 PHE PHE A . n A 1 66 ASN 66 128 128 ASN ASN A . n A 1 67 LYS 67 129 129 LYS LYS A . n A 1 68 TRP 68 130 130 TRP TRP A . n A 1 69 ASP 69 131 131 ASP ASP A . n A 1 70 ALA 70 132 132 ALA ALA A . n A 1 71 GLU 71 133 133 GLU GLU A . n A 1 72 ASN 72 134 134 ASN ASN A . n A 1 73 ALA 73 135 135 ALA ALA A . n A 1 74 ILE 74 136 136 ILE ILE A . n A 1 75 GLN 75 137 137 GLN GLN A . n A 1 76 GLN 76 138 138 GLN GLN A . n A 1 77 MET 77 139 139 MET MET A . n A 1 78 GLY 78 140 140 GLY GLY A . n A 1 79 GLY 79 141 141 GLY GLY A . n A 1 80 GLN 80 142 142 GLN GLN A . n A 1 81 TRP 81 143 143 TRP TRP A . n A 1 82 LEU 82 144 144 LEU LEU A . n A 1 83 GLY 83 145 145 GLY GLY A . n A 1 84 GLY 84 146 146 GLY GLY A . n A 1 85 ARG 85 147 147 ARG ARG A . n A 1 86 GLN 86 148 148 GLN GLN A . n A 1 87 ILE 87 149 149 ILE ILE A . n A 1 88 ARG 88 150 150 ARG ARG A . n A 1 89 THR 89 151 151 THR THR A . n A 1 90 ASN 90 152 152 ASN ASN A . n A 1 91 TRP 91 153 153 TRP TRP A . n A 1 92 ALA 92 154 154 ALA ALA A . n A 1 93 THR 93 155 155 THR THR A . n A 1 94 ARG 94 156 156 ARG ARG A . n A 1 95 LYS 95 157 157 LYS LYS A . n A 1 96 PRO 96 158 158 PRO PRO A . n A 1 97 PRO 97 159 159 PRO PRO A . n A 1 98 ALA 98 160 160 ALA ALA A . n A 1 99 PRO 99 161 161 PRO PRO A . n A 1 100 LYS 100 162 162 LYS LYS A . n A 1 101 SER 101 163 163 SER SER A . n A 1 102 THR 102 164 164 THR THR A . n A 1 103 TYR 103 165 165 TYR TYR A . n A 1 104 GLU 104 166 166 GLU GLU A . n A 1 105 SER 105 167 167 SER SER A . n A 1 106 ASN 106 168 168 ASN ASN A . n A 1 107 THR 107 169 169 THR THR A . n A 1 108 LYS 108 170 170 LYS LYS A . n A 1 109 GLN 109 171 171 GLN GLN A . n A 1 110 SER 110 172 172 SER SER A . n A 1 111 GLY 111 173 173 GLY GLY A . n A 1 112 PRO 112 174 174 PRO PRO A . n A 1 113 SER 113 175 175 SER SER A . n A 1 114 SER 114 176 176 SER SER A . n A 1 115 GLY 115 177 177 GLY GLY A . n # _exptl.entry_id 2DGO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2DGO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2DGO _struct.title 'Solution structure of the RNA binding domain in cytotoxic granule-associated RNA binding protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DGO _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text ;RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TIA1_MOUSE _struct_ref.pdbx_db_accession P52912 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 105 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DGO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 109 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P52912 _struct_ref_seq.db_align_beg 105 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 199 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 70 _struct_ref_seq.pdbx_auth_seq_align_end 171 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DGO GLY A 1 ? UNP P52912 ? ? 'cloning artifact' 63 1 1 2DGO SER A 2 ? UNP P52912 ? ? 'cloning artifact' 64 2 1 2DGO SER A 3 ? UNP P52912 ? ? 'cloning artifact' 65 3 1 2DGO GLY A 4 ? UNP P52912 ? ? 'cloning artifact' 66 4 1 2DGO SER A 5 ? UNP P52912 ? ? 'cloning artifact' 67 5 1 2DGO SER A 6 ? UNP P52912 ? ? 'cloning artifact' 68 6 1 2DGO GLY A 7 ? UNP P52912 ? ? 'cloning artifact' 69 7 1 2DGO SER A 110 ? UNP P52912 ? ? 'cloning artifact' 172 8 1 2DGO GLY A 111 ? UNP P52912 ? ? 'cloning artifact' 173 9 1 2DGO PRO A 112 ? UNP P52912 ? ? 'cloning artifact' 174 10 1 2DGO SER A 113 ? UNP P52912 ? ? 'cloning artifact' 175 11 1 2DGO SER A 114 ? UNP P52912 ? ? 'cloning artifact' 176 12 1 2DGO GLY A 115 ? UNP P52912 ? ? 'cloning artifact' 177 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 28 ? ALA A 37 ? THR A 90 ALA A 99 1 ? 10 HELX_P HELX_P2 2 PRO A 38 ? GLY A 40 ? PRO A 100 GLY A 102 5 ? 3 HELX_P HELX_P3 3 ASN A 66 ? MET A 77 ? ASN A 128 MET A 139 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 42 ? LYS A 49 ? ILE A 104 LYS A 111 A 2 SER A 56 ? PHE A 64 ? SER A 118 PHE A 126 A 3 PHE A 16 ? GLY A 21 ? PHE A 78 GLY A 83 A 4 ARG A 88 ? TRP A 91 ? ARG A 150 TRP A 153 B 1 TRP A 81 ? LEU A 82 ? TRP A 143 LEU A 144 B 2 ARG A 85 ? GLN A 86 ? ARG A 147 GLN A 148 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASP A 44 ? N ASP A 106 O SER A 63 ? O SER A 125 A 2 3 O GLY A 60 ? O GLY A 122 N VAL A 20 ? N VAL A 82 A 3 4 N PHE A 19 ? N PHE A 81 O ASN A 90 ? O ASN A 152 B 1 2 N LEU A 82 ? N LEU A 144 O ARG A 85 ? O ARG A 147 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 65 ? ? -52.24 106.41 2 1 GLN A 70 ? ? -57.18 91.77 3 1 ASP A 73 ? ? -115.10 73.91 4 1 THR A 74 ? ? 36.63 45.43 5 1 ASN A 76 ? ? -98.72 50.13 6 1 SER A 105 ? ? -103.28 -64.53 7 1 ILE A 136 ? ? -38.60 -34.45 8 2 THR A 74 ? ? -104.39 46.58 9 2 ASN A 76 ? ? -104.98 47.44 10 2 SER A 105 ? ? -109.68 -63.73 11 2 SER A 118 ? ? -51.80 105.64 12 2 PRO A 159 ? ? -69.77 -176.29 13 2 TYR A 165 ? ? -173.79 143.02 14 3 ASP A 73 ? ? -107.05 43.75 15 3 THR A 74 ? ? 35.80 45.30 16 3 ASN A 76 ? ? -109.03 54.65 17 3 SER A 105 ? ? -107.33 -61.83 18 3 ASP A 131 ? ? -35.80 -39.11 19 3 ILE A 136 ? ? -38.76 -36.40 20 3 GLU A 166 ? ? -171.94 145.51 21 4 ASN A 76 ? ? -113.02 51.96 22 4 SER A 105 ? ? -106.73 -62.91 23 4 ALA A 154 ? ? -85.67 41.58 24 4 LYS A 162 ? ? -37.43 108.36 25 4 SER A 175 ? ? -170.60 122.61 26 5 LYS A 72 ? ? -96.33 43.21 27 5 PRO A 161 ? ? -69.75 93.99 28 5 SER A 167 ? ? -107.27 43.04 29 6 SER A 65 ? ? -90.38 -61.70 30 6 LYS A 72 ? ? -174.93 133.89 31 6 THR A 74 ? ? 35.22 53.26 32 6 ASN A 76 ? ? -110.33 50.38 33 6 SER A 118 ? ? -51.77 109.03 34 6 ASN A 168 ? ? -173.65 129.24 35 7 SER A 64 ? ? 34.60 42.16 36 7 GLN A 70 ? ? -50.78 170.03 37 7 SER A 105 ? ? -109.86 -60.76 38 7 ILE A 136 ? ? -37.76 -35.32 39 7 GLN A 142 ? ? -56.64 -177.26 40 7 ASN A 168 ? ? -59.27 170.61 41 8 SER A 65 ? ? -36.71 115.89 42 8 SER A 105 ? ? -102.50 -61.98 43 8 GLN A 142 ? ? -55.01 179.88 44 8 PRO A 161 ? ? -69.76 98.26 45 9 THR A 74 ? ? -90.93 39.72 46 9 SER A 118 ? ? -54.92 102.09 47 9 ASN A 168 ? ? -165.88 118.82 48 10 SER A 67 ? ? -123.45 -50.51 49 10 LYS A 72 ? ? -80.19 49.40 50 10 ASP A 73 ? ? -94.91 33.99 51 10 THR A 74 ? ? -64.54 75.74 52 10 ILE A 136 ? ? -37.67 -37.74 53 10 GLN A 142 ? ? -49.41 179.82 54 10 THR A 155 ? ? -42.36 160.28 55 10 SER A 163 ? ? -173.75 122.05 56 10 TYR A 165 ? ? -168.65 110.88 57 11 GLN A 70 ? ? -62.60 97.46 58 11 ASN A 76 ? ? -99.20 41.56 59 11 SER A 105 ? ? -105.10 -62.30 60 11 ILE A 136 ? ? -38.62 -36.57 61 11 GLN A 142 ? ? -50.63 178.89 62 11 PRO A 174 ? ? -69.75 -171.68 63 12 LYS A 71 ? ? -51.05 170.59 64 12 THR A 74 ? ? -119.17 78.70 65 12 SER A 105 ? ? -107.61 -62.72 66 12 ILE A 136 ? ? -39.20 -33.46 67 12 GLN A 142 ? ? -49.33 173.22 68 12 ARG A 156 ? ? -174.28 119.92 69 12 TYR A 165 ? ? -69.29 -177.99 70 12 GLU A 166 ? ? -174.67 135.77 71 13 LYS A 72 ? ? -87.16 44.86 72 13 ASP A 84 ? ? 72.43 38.92 73 13 SER A 105 ? ? -104.02 -65.10 74 13 SER A 118 ? ? -50.38 108.30 75 13 GLN A 148 ? ? -59.68 173.37 76 13 TRP A 153 ? ? -54.77 104.50 77 13 THR A 164 ? ? -171.35 139.31 78 13 TYR A 165 ? ? -169.52 119.13 79 13 SER A 175 ? ? 72.05 51.01 80 14 SER A 75 ? ? -97.98 -60.53 81 14 ASN A 76 ? ? -104.68 41.46 82 14 ASP A 131 ? ? -35.91 -39.91 83 14 ILE A 136 ? ? -38.92 -30.41 84 14 ALA A 160 ? ? -49.27 150.88 85 14 GLU A 166 ? ? -57.56 99.87 86 14 SER A 175 ? ? 35.19 39.75 87 15 ASP A 73 ? ? -45.81 155.87 88 15 THR A 115 ? ? -131.14 -34.28 89 15 ILE A 136 ? ? -37.01 -36.76 90 15 SER A 167 ? ? -171.78 131.37 91 15 SER A 176 ? ? -165.72 106.89 92 16 LYS A 71 ? ? -91.00 53.68 93 16 SER A 105 ? ? -107.33 -62.94 94 16 SER A 118 ? ? -37.70 111.76 95 16 ILE A 136 ? ? -38.73 -35.50 96 16 THR A 155 ? ? 34.95 41.42 97 16 ALA A 160 ? ? -46.07 161.65 98 16 GLU A 166 ? ? -172.05 147.05 99 16 THR A 169 ? ? -172.88 141.52 100 16 LYS A 170 ? ? -170.68 136.12 101 16 SER A 175 ? ? -36.71 137.37 102 17 ILE A 136 ? ? -38.17 -35.82 103 17 GLN A 142 ? ? -56.55 -179.92 104 17 PRO A 159 ? ? -69.72 -172.09 105 17 LYS A 162 ? ? -174.95 147.78 106 17 SER A 175 ? ? -173.92 124.06 107 18 SER A 64 ? ? -64.84 98.66 108 18 SER A 68 ? ? -166.47 115.54 109 18 ILE A 136 ? ? -38.44 -36.37 110 18 ARG A 156 ? ? -116.50 50.17 111 18 PRO A 159 ? ? -69.82 -174.45 112 18 TYR A 165 ? ? -39.15 157.91 113 18 PRO A 174 ? ? -69.81 97.55 114 19 THR A 74 ? ? -106.37 43.06 115 19 ASN A 76 ? ? -105.55 46.56 116 19 PRO A 174 ? ? -69.73 95.66 117 19 SER A 175 ? ? -43.09 166.60 118 19 SER A 176 ? ? -121.22 -54.61 119 20 ASN A 76 ? ? -108.33 42.02 120 20 ILE A 136 ? ? -39.83 -37.35 121 20 GLN A 142 ? ? -67.69 -177.94 122 20 THR A 164 ? ? -39.75 136.60 123 20 PRO A 174 ? ? -69.80 97.35 124 20 SER A 176 ? ? -125.96 -61.02 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2DGO _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the lowest energy,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DGO _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20mM d-Tris-HCl(pH7.0), 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2DGO _pdbx_nmr_refine.method 'torsion angle dynamics,restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 Delaglio,F 2 'data analysis' NMRView 5.0.4 Johnson,B.A 3 'data analysis' KUJIRA 0.932 Kobayashi,N 4 'structure solution' CYANA 2.0 Guntert,P 5 refinement CYANA 2.0 Guntert,P 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2DGO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_