data_2DJB # _entry.id 2DJB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DJB pdb_00002djb 10.2210/pdb2djb/pdb RCSB RCSB025480 ? ? WWPDB D_1000025480 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-03-13 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_dist_value' 6 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 4 'Structure model' '_struct_ref_seq_dif.details' 19 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 20 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 21 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DJB _pdbx_database_status.recvd_initial_deposition_date 2006-03-31 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Miyamoto, K.' 1 'Kigawa, T.' 2 'Sato, M.' 3 'Koshiba, S.' 4 'Inoue, M.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the RING domain of the human Polycomb group RING finger protein 6' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Miyamoto, K.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Sato, M.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Inoue, M.' 5 ? primary 'Yokoyama, S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polycomb group RING finger protein 6' 7796.919 1 ? ? 'RING domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RING finger protein 134, Mel18 and Bmi1-like RING finger' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGNLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGNLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ASN n 1 9 LEU n 1 10 SER n 1 11 GLU n 1 12 LEU n 1 13 THR n 1 14 PRO n 1 15 TYR n 1 16 ILE n 1 17 LEU n 1 18 CYS n 1 19 SER n 1 20 ILE n 1 21 CYS n 1 22 LYS n 1 23 GLY n 1 24 TYR n 1 25 LEU n 1 26 ILE n 1 27 ASP n 1 28 ALA n 1 29 THR n 1 30 THR n 1 31 ILE n 1 32 THR n 1 33 GLU n 1 34 CYS n 1 35 LEU n 1 36 HIS n 1 37 THR n 1 38 PHE n 1 39 CYS n 1 40 LYS n 1 41 SER n 1 42 CYS n 1 43 ILE n 1 44 VAL n 1 45 ARG n 1 46 HIS n 1 47 PHE n 1 48 TYR n 1 49 TYR n 1 50 SER n 1 51 ASN n 1 52 ARG n 1 53 CYS n 1 54 PRO n 1 55 LYS n 1 56 CYS n 1 57 ASN n 1 58 ILE n 1 59 VAL n 1 60 VAL n 1 61 HIS n 1 62 GLN n 1 63 THR n 1 64 GLN n 1 65 PRO n 1 66 LEU n 1 67 SER n 1 68 GLY n 1 69 PRO n 1 70 SER n 1 71 SER n 1 72 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'PCGF6, MBLR, RNF134' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050302-15 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _exptl.entry_id 2DJB _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2DJB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2DJB _struct.title 'Solution structure of the RING domain of the human Polycomb group RING finger protein 6' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DJB _struct_keywords.pdbx_keywords 'GENE REGULATION' _struct_keywords.text ;Polycomb group RING finger protein 6, RING finger protein 134, PCGF6, RING domain, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PCGF6_HUMAN _struct_ref.pdbx_db_accession Q9BYE7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPL _struct_ref.pdbx_align_begin 126 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DJB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9BYE7 _struct_ref_seq.db_align_beg 126 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 184 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DJB GLY A 1 ? UNP Q9BYE7 ? ? 'cloning artifact' 1 1 1 2DJB SER A 2 ? UNP Q9BYE7 ? ? 'cloning artifact' 2 2 1 2DJB SER A 3 ? UNP Q9BYE7 ? ? 'cloning artifact' 3 3 1 2DJB GLY A 4 ? UNP Q9BYE7 ? ? 'cloning artifact' 4 4 1 2DJB SER A 5 ? UNP Q9BYE7 ? ? 'cloning artifact' 5 5 1 2DJB SER A 6 ? UNP Q9BYE7 ? ? 'cloning artifact' 6 6 1 2DJB GLY A 7 ? UNP Q9BYE7 ? ? 'cloning artifact' 7 7 1 2DJB SER A 67 ? UNP Q9BYE7 ? ? 'cloning artifact' 67 8 1 2DJB GLY A 68 ? UNP Q9BYE7 ? ? 'cloning artifact' 68 9 1 2DJB PRO A 69 ? UNP Q9BYE7 ? ? 'cloning artifact' 69 10 1 2DJB SER A 70 ? UNP Q9BYE7 ? ? 'cloning artifact' 70 11 1 2DJB SER A 71 ? UNP Q9BYE7 ? ? 'cloning artifact' 71 12 1 2DJB GLY A 72 ? UNP Q9BYE7 ? ? 'cloning artifact' 72 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 39 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 50 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 39 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 50 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.320 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.321 ? ? metalc3 metalc ? ? A CYS 34 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 34 A ZN 401 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc4 metalc ? ? A HIS 36 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 36 A ZN 401 1_555 ? ? ? ? ? ? ? 2.300 ? ? metalc5 metalc ? ? A CYS 39 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 39 A ZN 201 1_555 ? ? ? ? ? ? ? 2.354 ? ? metalc6 metalc ? ? A CYS 42 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 42 A ZN 201 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc7 metalc ? ? A CYS 53 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 53 A ZN 401 1_555 ? ? ? ? ? ? ? 2.321 ? ? metalc8 metalc ? ? A CYS 56 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 56 A ZN 401 1_555 ? ? ? ? ? ? ? 2.312 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 119.2 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 107.3 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 105.1 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 119.1 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 87.0 ? 6 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 117.6 ? 7 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 36 ? A HIS 36 ? 1_555 87.3 ? 8 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 53 ? A CYS 53 ? 1_555 106.5 ? 9 ND1 ? A HIS 36 ? A HIS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 53 ? A CYS 53 ? 1_555 120.6 ? 10 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 56 ? A CYS 56 ? 1_555 93.9 ? 11 ND1 ? A HIS 36 ? A HIS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 56 ? A CYS 56 ? 1_555 120.9 ? 12 SG ? A CYS 53 ? A CYS 53 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 56 ? A CYS 56 ? 1_555 115.4 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 29 ? THR A 30 ? THR A 29 THR A 30 A 2 THR A 37 ? PHE A 38 ? THR A 37 PHE A 38 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 29 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 29 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 38 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 38 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 5 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 4 AC1 4 CYS A 42 ? CYS A 42 . ? 1_555 ? 5 AC2 5 CYS A 34 ? CYS A 34 . ? 1_555 ? 6 AC2 5 HIS A 36 ? HIS A 36 . ? 1_555 ? 7 AC2 5 CYS A 53 ? CYS A 53 . ? 1_555 ? 8 AC2 5 LYS A 55 ? LYS A 55 . ? 1_555 ? 9 AC2 5 CYS A 56 ? CYS A 56 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -92.17 -61.71 2 1 PRO A 14 ? ? -69.83 3.36 3 1 ILE A 16 ? ? -38.87 -35.91 4 1 ILE A 20 ? ? -99.43 -65.82 5 1 ILE A 26 ? ? -120.35 -61.99 6 1 ALA A 28 ? ? 74.74 47.61 7 1 GLU A 33 ? ? -109.30 -68.99 8 1 ASN A 51 ? ? -81.84 33.81 9 1 PRO A 54 ? ? -69.77 10.00 10 1 ASN A 57 ? ? 73.96 46.78 11 1 HIS A 61 ? ? -97.36 56.82 12 1 GLN A 62 ? ? -105.43 -61.33 13 1 PRO A 69 ? ? -69.77 -169.20 14 1 SER A 70 ? ? -94.72 40.94 15 2 LEU A 12 ? ? -116.33 53.56 16 2 ILE A 16 ? ? -36.36 -36.98 17 2 LYS A 22 ? ? 37.80 36.98 18 2 LEU A 25 ? ? -65.51 86.83 19 2 ALA A 28 ? ? -31.32 137.73 20 2 THR A 32 ? ? -31.01 -39.08 21 2 ASN A 51 ? ? -78.95 43.68 22 2 PRO A 54 ? ? -69.78 8.39 23 2 ASN A 57 ? ? 71.39 54.45 24 2 VAL A 59 ? ? -69.91 79.23 25 2 PRO A 65 ? ? -69.81 84.24 26 2 LEU A 66 ? ? -56.64 99.65 27 2 SER A 71 ? ? -84.97 42.29 28 3 ILE A 16 ? ? -66.50 71.84 29 3 ALA A 28 ? ? 70.63 54.89 30 3 THR A 32 ? ? -32.82 -35.45 31 3 LEU A 35 ? ? 38.27 47.60 32 3 ILE A 43 ? ? -38.73 -32.92 33 3 ASN A 51 ? ? -75.33 49.22 34 3 PRO A 54 ? ? -69.80 9.39 35 3 LYS A 55 ? ? -121.96 -65.79 36 3 VAL A 59 ? ? -62.99 88.80 37 3 GLN A 62 ? ? -120.94 -56.61 38 3 THR A 63 ? ? -124.29 -56.81 39 3 LEU A 66 ? ? -34.83 144.47 40 3 PRO A 69 ? ? -69.78 -179.02 41 4 SER A 3 ? ? -122.13 -60.18 42 4 SER A 5 ? ? 38.40 43.63 43 4 PRO A 14 ? ? -69.76 -179.05 44 4 TYR A 15 ? ? -87.33 40.20 45 4 ASP A 27 ? ? -114.97 52.99 46 4 ALA A 28 ? ? -27.29 135.68 47 4 THR A 32 ? ? -32.09 -35.93 48 4 PRO A 54 ? ? -69.73 6.56 49 4 LYS A 55 ? ? -108.52 -69.98 50 4 ASN A 57 ? ? 74.97 51.48 51 4 VAL A 59 ? ? -68.94 89.79 52 4 HIS A 61 ? ? -100.39 -66.52 53 4 GLN A 62 ? ? -35.25 106.18 54 4 PRO A 65 ? ? -69.79 -91.20 55 5 SER A 2 ? ? -171.65 137.37 56 5 SER A 6 ? ? -174.98 131.18 57 5 ASN A 8 ? ? -170.24 117.11 58 5 TYR A 15 ? ? -121.65 -73.14 59 5 ALA A 28 ? ? 74.55 50.35 60 5 LEU A 35 ? ? 28.02 50.97 61 5 ASN A 51 ? ? -80.40 42.61 62 5 PRO A 54 ? ? -69.74 8.33 63 5 ASN A 57 ? ? 70.66 43.63 64 5 VAL A 59 ? ? -69.89 98.19 65 5 SER A 71 ? ? -42.86 155.81 66 6 SER A 10 ? ? -174.74 126.16 67 6 LEU A 12 ? ? -175.19 143.21 68 6 PRO A 14 ? ? -69.72 -171.51 69 6 LEU A 17 ? ? -58.40 170.57 70 6 ILE A 26 ? ? -109.32 -64.53 71 6 THR A 32 ? ? -27.18 -45.46 72 6 PRO A 54 ? ? -69.76 10.44 73 6 LYS A 55 ? ? -122.66 -70.51 74 6 VAL A 59 ? ? -56.96 91.76 75 6 SER A 71 ? ? -126.61 -52.11 76 7 LEU A 9 ? ? 34.58 53.99 77 7 PRO A 14 ? ? -69.79 80.12 78 7 LEU A 17 ? ? -42.01 162.84 79 7 ILE A 26 ? ? -108.08 -61.15 80 7 ASN A 51 ? ? -75.00 48.57 81 7 PRO A 54 ? ? -69.81 8.92 82 7 VAL A 59 ? ? -62.11 94.38 83 7 GLN A 62 ? ? -105.11 73.85 84 7 LEU A 66 ? ? -37.79 151.38 85 7 SER A 67 ? ? -125.37 -58.15 86 7 PRO A 69 ? ? -69.72 -177.02 87 8 LEU A 9 ? ? -174.79 112.79 88 8 TYR A 24 ? ? -35.22 139.33 89 8 THR A 32 ? ? -33.41 -33.47 90 8 CYS A 39 ? ? -34.63 151.17 91 8 ASN A 51 ? ? -78.17 41.32 92 8 PRO A 54 ? ? -69.72 8.17 93 8 LYS A 55 ? ? -109.76 -70.88 94 8 THR A 63 ? ? -39.16 134.72 95 8 PRO A 65 ? ? -69.75 4.67 96 9 SER A 2 ? ? -170.14 145.37 97 9 SER A 5 ? ? -170.08 149.34 98 9 PRO A 14 ? ? -69.72 -163.83 99 9 TYR A 15 ? ? -84.75 43.97 100 9 ILE A 16 ? ? -111.95 67.87 101 9 LYS A 22 ? ? 41.85 29.06 102 9 CYS A 39 ? ? -37.12 132.59 103 9 ASN A 51 ? ? -79.55 40.80 104 9 PRO A 54 ? ? -69.73 11.69 105 9 LYS A 55 ? ? -115.15 -70.08 106 9 GLN A 62 ? ? -171.32 144.55 107 9 LEU A 66 ? ? -96.01 41.71 108 9 PRO A 69 ? ? -69.78 -177.64 109 10 ASN A 8 ? ? -169.98 112.79 110 10 PRO A 14 ? ? -69.68 -179.87 111 10 TYR A 15 ? ? -89.37 40.10 112 10 LEU A 17 ? ? -54.53 178.91 113 10 TYR A 24 ? ? -33.45 138.98 114 10 ALA A 28 ? ? 73.72 47.95 115 10 THR A 32 ? ? -30.73 -35.36 116 10 CYS A 39 ? ? -38.60 131.09 117 10 ASN A 51 ? ? -93.41 40.65 118 10 PRO A 54 ? ? -69.73 11.47 119 10 VAL A 59 ? ? -69.08 95.69 120 10 SER A 71 ? ? -49.95 154.65 121 11 SER A 6 ? ? -125.69 -61.74 122 11 GLU A 11 ? ? 34.51 40.74 123 11 LEU A 12 ? ? -56.63 90.40 124 11 TYR A 15 ? ? -121.09 -72.80 125 11 LEU A 17 ? ? -46.77 169.13 126 11 ILE A 20 ? ? -90.63 -60.12 127 11 TYR A 24 ? ? -33.97 126.27 128 11 ALA A 28 ? ? -30.84 138.95 129 11 GLU A 33 ? ? -96.16 -70.64 130 11 CYS A 39 ? ? -46.75 163.34 131 11 PRO A 54 ? ? -69.81 11.03 132 11 VAL A 59 ? ? -65.24 83.46 133 11 GLN A 62 ? ? -93.38 42.89 134 11 PRO A 65 ? ? -69.77 2.11 135 12 PRO A 14 ? ? -69.77 5.13 136 12 TYR A 15 ? ? -80.08 40.34 137 12 LEU A 17 ? ? -48.52 175.56 138 12 TYR A 24 ? ? -39.37 140.86 139 12 ILE A 26 ? ? -125.59 -58.56 140 12 ALA A 28 ? ? 70.48 54.13 141 12 GLU A 33 ? ? -89.62 -73.50 142 12 ASN A 51 ? ? -77.09 45.85 143 12 PRO A 54 ? ? -69.71 7.56 144 12 LYS A 55 ? ? -113.49 -70.83 145 12 ASN A 57 ? ? 72.87 54.99 146 13 SER A 2 ? ? -172.86 115.94 147 13 PRO A 14 ? ? -69.77 -175.93 148 13 LEU A 17 ? ? -49.15 172.88 149 13 ILE A 26 ? ? -97.29 -65.89 150 13 GLU A 33 ? ? -81.33 -71.30 151 13 CYS A 39 ? ? -48.84 179.63 152 13 ASN A 51 ? ? -77.36 42.18 153 13 PRO A 54 ? ? -69.75 7.99 154 13 VAL A 59 ? ? -61.41 89.15 155 13 LEU A 66 ? ? -106.35 41.51 156 13 PRO A 69 ? ? -69.79 11.80 157 13 SER A 70 ? ? -28.05 96.58 158 14 TYR A 15 ? ? -83.26 40.46 159 14 TYR A 24 ? ? -33.98 137.13 160 14 ALA A 28 ? ? 74.98 48.38 161 14 ASN A 51 ? ? -76.55 44.19 162 14 PRO A 54 ? ? -69.75 4.33 163 14 LYS A 55 ? ? -109.91 -71.22 164 14 ASN A 57 ? ? 73.36 51.40 165 14 VAL A 59 ? ? -68.16 91.71 166 15 SER A 5 ? ? -171.91 134.81 167 15 GLU A 11 ? ? -37.65 154.76 168 15 PRO A 14 ? ? -69.71 3.87 169 15 TYR A 15 ? ? -83.63 30.93 170 15 LEU A 17 ? ? -50.05 171.05 171 15 ILE A 20 ? ? -90.24 -62.47 172 15 TYR A 24 ? ? -34.89 143.54 173 15 ALA A 28 ? ? 70.71 54.63 174 15 GLU A 33 ? ? -59.24 -72.00 175 15 LYS A 40 ? ? -39.03 -27.17 176 15 ASN A 51 ? ? -74.47 47.52 177 15 PRO A 54 ? ? -69.76 9.50 178 16 TYR A 15 ? ? -84.54 -74.19 179 16 ALA A 28 ? ? 72.40 54.99 180 16 ASN A 51 ? ? -84.58 43.30 181 16 PRO A 54 ? ? -69.79 7.39 182 16 LYS A 55 ? ? -108.63 -70.08 183 16 ASN A 57 ? ? 71.85 50.14 184 16 HIS A 61 ? ? -46.71 107.82 185 16 PRO A 65 ? ? -69.76 -165.76 186 16 PRO A 69 ? ? -69.70 12.63 187 17 ASN A 8 ? ? -174.39 111.38 188 17 PRO A 14 ? ? -69.86 3.53 189 17 LEU A 17 ? ? -53.85 177.29 190 17 ILE A 20 ? ? -93.74 -64.30 191 17 LEU A 35 ? ? 72.53 52.47 192 17 ASN A 51 ? ? -76.02 43.36 193 17 PRO A 54 ? ? -69.66 5.40 194 17 LYS A 55 ? ? -115.78 -70.34 195 17 ASN A 57 ? ? 75.07 54.39 196 17 VAL A 59 ? ? -57.63 94.74 197 17 HIS A 61 ? ? -81.30 43.93 198 17 LEU A 66 ? ? -59.59 109.59 199 17 PRO A 69 ? ? -69.80 2.08 200 18 SER A 3 ? ? -172.78 147.07 201 18 LEU A 25 ? ? -67.47 85.74 202 18 ALA A 28 ? ? -24.92 130.22 203 18 GLU A 33 ? ? -135.01 -68.84 204 18 CYS A 39 ? ? -34.45 142.76 205 18 ASN A 51 ? ? -77.23 44.30 206 18 PRO A 54 ? ? -69.77 9.87 207 18 GLN A 62 ? ? 32.99 44.54 208 18 PRO A 69 ? ? -69.74 -173.96 209 19 PRO A 14 ? ? -69.84 85.78 210 19 TYR A 15 ? ? -53.26 101.04 211 19 ILE A 16 ? ? -65.79 99.33 212 19 LEU A 25 ? ? -67.26 85.76 213 19 GLU A 33 ? ? -102.80 -72.74 214 19 CYS A 39 ? ? -37.81 131.96 215 19 ASN A 51 ? ? -75.68 47.38 216 19 PRO A 54 ? ? -69.78 10.45 217 19 LYS A 55 ? ? -114.56 -70.10 218 19 HIS A 61 ? ? -110.63 75.89 219 19 SER A 70 ? ? -49.87 107.87 220 20 SER A 6 ? ? -172.08 136.67 221 20 SER A 10 ? ? -167.21 107.44 222 20 LEU A 12 ? ? -164.42 105.67 223 20 TYR A 15 ? ? -78.08 47.20 224 20 LEU A 17 ? ? -52.80 176.60 225 20 TYR A 24 ? ? -34.52 131.08 226 20 ALA A 28 ? ? 73.50 51.60 227 20 GLU A 33 ? ? -72.26 -71.13 228 20 ASN A 51 ? ? -76.02 44.25 229 20 PRO A 54 ? ? -69.78 8.15 230 20 GLN A 62 ? ? -56.23 95.16 231 20 PRO A 65 ? ? -69.71 12.09 232 20 LEU A 66 ? ? -171.13 109.12 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # _pdbx_nmr_ensemble.entry_id 2DJB _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DJB _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.43mM RING domain U-13C,15N; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZNCl2; 1.0mM IDA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2DJB _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9732 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TYR N N N N 298 TYR CA C N S 299 TYR C C N N 300 TYR O O N N 301 TYR CB C N N 302 TYR CG C Y N 303 TYR CD1 C Y N 304 TYR CD2 C Y N 305 TYR CE1 C Y N 306 TYR CE2 C Y N 307 TYR CZ C Y N 308 TYR OH O N N 309 TYR OXT O N N 310 TYR H H N N 311 TYR H2 H N N 312 TYR HA H N N 313 TYR HB2 H N N 314 TYR HB3 H N N 315 TYR HD1 H N N 316 TYR HD2 H N N 317 TYR HE1 H N N 318 TYR HE2 H N N 319 TYR HH H N N 320 TYR HXT H N N 321 VAL N N N N 322 VAL CA C N S 323 VAL C C N N 324 VAL O O N N 325 VAL CB C N N 326 VAL CG1 C N N 327 VAL CG2 C N N 328 VAL OXT O N N 329 VAL H H N N 330 VAL H2 H N N 331 VAL HA H N N 332 VAL HB H N N 333 VAL HG11 H N N 334 VAL HG12 H N N 335 VAL HG13 H N N 336 VAL HG21 H N N 337 VAL HG22 H N N 338 VAL HG23 H N N 339 VAL HXT H N N 340 ZN ZN ZN N N 341 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TYR N CA sing N N 285 TYR N H sing N N 286 TYR N H2 sing N N 287 TYR CA C sing N N 288 TYR CA CB sing N N 289 TYR CA HA sing N N 290 TYR C O doub N N 291 TYR C OXT sing N N 292 TYR CB CG sing N N 293 TYR CB HB2 sing N N 294 TYR CB HB3 sing N N 295 TYR CG CD1 doub Y N 296 TYR CG CD2 sing Y N 297 TYR CD1 CE1 sing Y N 298 TYR CD1 HD1 sing N N 299 TYR CD2 CE2 doub Y N 300 TYR CD2 HD2 sing N N 301 TYR CE1 CZ doub Y N 302 TYR CE1 HE1 sing N N 303 TYR CE2 CZ sing Y N 304 TYR CE2 HE2 sing N N 305 TYR CZ OH sing N N 306 TYR OH HH sing N N 307 TYR OXT HXT sing N N 308 VAL N CA sing N N 309 VAL N H sing N N 310 VAL N H2 sing N N 311 VAL CA C sing N N 312 VAL CA CB sing N N 313 VAL CA HA sing N N 314 VAL C O doub N N 315 VAL C OXT sing N N 316 VAL CB CG1 sing N N 317 VAL CB CG2 sing N N 318 VAL CB HB sing N N 319 VAL CG1 HG11 sing N N 320 VAL CG1 HG12 sing N N 321 VAL CG1 HG13 sing N N 322 VAL CG2 HG21 sing N N 323 VAL CG2 HG22 sing N N 324 VAL CG2 HG23 sing N N 325 VAL OXT HXT sing N N 326 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2DJB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_