data_2DJS # _entry.id 2DJS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DJS pdb_00002djs 10.2210/pdb2djs/pdb RCSB RCSB025497 ? ? WWPDB D_1000025497 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso002001071.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DJS _pdbx_database_status.recvd_initial_deposition_date 2006-04-05 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sato, M.' 1 'Tochio, N.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structures of the fn3 domain of human ephrin type-B receptor 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sato, M.' 1 ? primary 'Tochio, N.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ephrin type-B receptor 1' _entity.formula_weight 11804.199 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.1.112 _entity.pdbx_mutation ? _entity.pdbx_fragment 'Fibronectin type III domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFNSSMARSQTNTARIDGLRPGMVYVVQV RARTVAGYGKFSGKMCFQTLTDSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFNSSMARSQTNTARIDGLRPGMVYVVQV RARTVAGYGKFSGKMCFQTLTDSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso002001071.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 SER n 1 10 THR n 1 11 VAL n 1 12 PRO n 1 13 ILE n 1 14 MET n 1 15 HIS n 1 16 GLN n 1 17 VAL n 1 18 SER n 1 19 ALA n 1 20 THR n 1 21 MET n 1 22 ARG n 1 23 SER n 1 24 ILE n 1 25 THR n 1 26 LEU n 1 27 SER n 1 28 TRP n 1 29 PRO n 1 30 GLN n 1 31 PRO n 1 32 GLU n 1 33 GLN n 1 34 PRO n 1 35 ASN n 1 36 GLY n 1 37 ILE n 1 38 ILE n 1 39 LEU n 1 40 ASP n 1 41 TYR n 1 42 GLU n 1 43 ILE n 1 44 ARG n 1 45 TYR n 1 46 TYR n 1 47 GLU n 1 48 LYS n 1 49 GLU n 1 50 HIS n 1 51 ASN n 1 52 GLU n 1 53 PHE n 1 54 ASN n 1 55 SER n 1 56 SER n 1 57 MET n 1 58 ALA n 1 59 ARG n 1 60 SER n 1 61 GLN n 1 62 THR n 1 63 ASN n 1 64 THR n 1 65 ALA n 1 66 ARG n 1 67 ILE n 1 68 ASP n 1 69 GLY n 1 70 LEU n 1 71 ARG n 1 72 PRO n 1 73 GLY n 1 74 MET n 1 75 VAL n 1 76 TYR n 1 77 VAL n 1 78 VAL n 1 79 GLN n 1 80 VAL n 1 81 ARG n 1 82 ALA n 1 83 ARG n 1 84 THR n 1 85 VAL n 1 86 ALA n 1 87 GLY n 1 88 TYR n 1 89 GLY n 1 90 LYS n 1 91 PHE n 1 92 SER n 1 93 GLY n 1 94 LYS n 1 95 MET n 1 96 CYS n 1 97 PHE n 1 98 GLN n 1 99 THR n 1 100 LEU n 1 101 THR n 1 102 ASP n 1 103 SER n 1 104 GLY n 1 105 PRO n 1 106 SER n 1 107 SER n 1 108 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene EPHB1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050912-11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EPHB1_HUMAN _struct_ref.pdbx_db_accession P54762 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 434 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DJS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 102 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P54762 _struct_ref_seq.db_align_beg 434 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 528 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 102 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DJS GLY A 1 ? UNP P54762 ? ? 'cloning artifact' 1 1 1 2DJS SER A 2 ? UNP P54762 ? ? 'cloning artifact' 2 2 1 2DJS SER A 3 ? UNP P54762 ? ? 'cloning artifact' 3 3 1 2DJS GLY A 4 ? UNP P54762 ? ? 'cloning artifact' 4 4 1 2DJS SER A 5 ? UNP P54762 ? ? 'cloning artifact' 5 5 1 2DJS SER A 6 ? UNP P54762 ? ? 'cloning artifact' 6 6 1 2DJS GLY A 7 ? UNP P54762 ? ? 'cloning artifact' 7 7 1 2DJS SER A 103 ? UNP P54762 ? ? 'cloning artifact' 103 8 1 2DJS GLY A 104 ? UNP P54762 ? ? 'cloning artifact' 104 9 1 2DJS PRO A 105 ? UNP P54762 ? ? 'cloning artifact' 105 10 1 2DJS SER A 106 ? UNP P54762 ? ? 'cloning artifact' 106 11 1 2DJS SER A 107 ? UNP P54762 ? ? 'cloning artifact' 107 12 1 2DJS GLY A 108 ? UNP P54762 ? ? 'cloning artifact' 108 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM fn3 domain U-15N, 13C; 20mM d-Tris HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DJS _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DJS _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DJS _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DJS _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DJS _struct.title 'Solution structures of the fn3 domain of human ephrin type-B receptor 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DJS _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;Tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? C ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 15 ? ALA A 19 ? HIS A 15 ALA A 19 A 2 SER A 23 ? SER A 27 ? SER A 23 SER A 27 A 3 THR A 64 ? ASP A 68 ? THR A 64 ASP A 68 B 1 SER A 56 ? SER A 60 ? SER A 56 SER A 60 B 2 ILE A 38 ? GLU A 47 ? ILE A 38 GLU A 47 B 3 VAL A 75 ? THR A 84 ? VAL A 75 THR A 84 B 4 TYR A 88 ? PHE A 91 ? TYR A 88 PHE A 91 C 1 SER A 56 ? SER A 60 ? SER A 56 SER A 60 C 2 ILE A 38 ? GLU A 47 ? ILE A 38 GLU A 47 C 3 VAL A 75 ? THR A 84 ? VAL A 75 THR A 84 C 4 MET A 95 ? GLN A 98 ? MET A 95 GLN A 98 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 15 ? N HIS A 15 O SER A 27 ? O SER A 27 A 2 3 N ILE A 24 ? N ILE A 24 O ILE A 67 ? O ILE A 67 B 1 2 O ALA A 58 ? O ALA A 58 N ILE A 43 ? N ILE A 43 B 2 3 N GLU A 42 ? N GLU A 42 O ARG A 81 ? O ARG A 81 B 3 4 N ALA A 82 ? N ALA A 82 O GLY A 89 ? O GLY A 89 C 1 2 O ALA A 58 ? O ALA A 58 N ILE A 43 ? N ILE A 43 C 2 3 N GLU A 42 ? N GLU A 42 O ARG A 81 ? O ARG A 81 C 3 4 N TYR A 76 ? N TYR A 76 O PHE A 97 ? O PHE A 97 # _database_PDB_matrix.entry_id 2DJS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DJS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 CYS 96 96 96 CYS CYS A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 GLY 108 108 108 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-05 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 9 ? ? -56.91 -174.87 2 1 ALA A 19 ? ? -173.92 145.66 3 1 GLN A 33 ? ? -118.43 56.05 4 1 PRO A 34 ? ? -69.75 0.38 5 1 ASP A 102 ? ? -98.08 43.42 6 2 PRO A 34 ? ? -69.72 2.41 7 2 SER A 103 ? ? -125.84 -56.75 8 3 SER A 9 ? ? -59.85 -179.31 9 3 GLN A 33 ? ? -118.55 53.20 10 3 PRO A 34 ? ? -69.75 1.97 11 3 LYS A 94 ? ? -40.67 155.44 12 4 SER A 3 ? ? -56.91 105.67 13 4 SER A 9 ? ? -48.80 175.46 14 4 ALA A 19 ? ? -171.72 142.69 15 4 PRO A 34 ? ? -69.75 0.43 16 4 ASN A 35 ? ? 42.07 25.04 17 4 ILE A 37 ? ? -37.63 141.85 18 4 ASN A 54 ? ? -78.56 49.21 19 4 SER A 103 ? ? -173.98 149.64 20 4 SER A 106 ? ? 34.62 47.53 21 5 PRO A 34 ? ? -69.76 0.42 22 5 ASN A 35 ? ? 45.73 29.36 23 6 SER A 9 ? ? -64.73 -179.46 24 6 GLN A 33 ? ? -119.95 53.83 25 6 ILE A 37 ? ? -52.27 107.75 26 6 ASN A 54 ? ? -104.56 61.42 27 6 SER A 107 ? ? -59.76 176.66 28 7 SER A 5 ? ? -41.62 154.86 29 7 SER A 9 ? ? -50.94 175.69 30 8 SER A 2 ? ? -36.64 105.74 31 8 SER A 9 ? ? -51.94 175.57 32 8 PRO A 34 ? ? -69.76 2.57 33 8 ASN A 54 ? ? -94.76 48.78 34 8 PRO A 105 ? ? -69.73 -178.68 35 8 SER A 106 ? ? -173.36 145.55 36 9 SER A 2 ? ? -88.71 42.44 37 9 ALA A 19 ? ? -175.03 145.75 38 9 PRO A 34 ? ? -69.75 0.83 39 9 ASN A 35 ? ? 42.79 25.31 40 9 ILE A 37 ? ? -39.97 134.46 41 9 ASP A 102 ? ? -86.90 39.44 42 10 ALA A 19 ? ? -172.30 146.59 43 10 PRO A 29 ? ? -69.75 -179.45 44 10 GLN A 33 ? ? -119.55 51.11 45 10 PRO A 34 ? ? -69.81 2.35 46 10 SER A 107 ? ? -55.78 176.17 47 11 SER A 9 ? ? -56.88 171.08 48 12 GLN A 33 ? ? -119.55 50.41 49 12 PRO A 34 ? ? -69.78 2.40 50 12 ASN A 54 ? ? -104.36 53.93 51 13 SER A 9 ? ? -46.16 158.61 52 13 ALA A 19 ? ? -174.73 146.73 53 13 GLN A 33 ? ? -118.29 50.58 54 13 ASN A 54 ? ? -92.80 51.95 55 13 SER A 106 ? ? -103.78 41.97 56 14 SER A 9 ? ? -57.87 174.34 57 14 PRO A 34 ? ? -69.70 0.80 58 14 ILE A 37 ? ? -39.13 143.22 59 14 GLU A 47 ? ? -36.36 122.88 60 14 ASN A 54 ? ? -104.63 55.11 61 14 LYS A 94 ? ? -38.01 132.20 62 14 THR A 99 ? ? -61.73 -179.71 63 15 SER A 2 ? ? -65.47 94.31 64 15 SER A 9 ? ? -48.99 176.58 65 15 VAL A 11 ? ? -36.39 138.06 66 15 GLN A 33 ? ? -118.80 56.87 67 15 ILE A 37 ? ? -56.15 105.10 68 15 ASN A 54 ? ? -102.58 66.11 69 16 SER A 9 ? ? -55.47 -177.22 70 16 PRO A 34 ? ? -69.81 2.97 71 16 GLU A 47 ? ? -38.31 140.22 72 16 ASN A 54 ? ? -102.58 41.37 73 17 SER A 6 ? ? 37.86 33.99 74 17 SER A 9 ? ? -48.73 161.25 75 17 PRO A 34 ? ? -69.75 2.40 76 17 ASN A 35 ? ? 48.99 28.32 77 17 SER A 103 ? ? 36.86 37.84 78 18 SER A 3 ? ? -173.64 113.96 79 18 SER A 6 ? ? -59.27 106.10 80 18 SER A 9 ? ? -47.48 168.15 81 18 LYS A 94 ? ? -37.76 131.77 82 18 ASP A 102 ? ? -83.03 47.66 83 18 SER A 103 ? ? -94.82 -66.98 84 19 SER A 9 ? ? -59.41 -176.29 85 19 PRO A 34 ? ? -69.73 2.09 86 19 ASN A 35 ? ? 48.13 27.50 87 19 ILE A 37 ? ? -57.17 107.16 88 20 SER A 9 ? ? -48.13 172.59 89 20 ALA A 19 ? ? -174.46 149.04 90 20 PRO A 34 ? ? -69.81 0.90 91 20 ASN A 35 ? ? 46.65 29.01 #