data_2DK7 # _entry.id 2DK7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DK7 pdb_00002dk7 10.2210/pdb2dk7/pdb RCSB RCSB025512 ? ? WWPDB D_1000025512 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DK7 _pdbx_database_status.recvd_initial_deposition_date 2006-04-06 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of WW domain in transcription elongation regulator 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Transcription elongation regulator 1' _entity.formula_weight 7863.812 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'WW domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TATA box-binding protein- associated factor 2S, Transcription factor CA150' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGKAKPVATAPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKKSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGKAKPVATAPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKKSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LYS n 1 9 ALA n 1 10 LYS n 1 11 PRO n 1 12 VAL n 1 13 ALA n 1 14 THR n 1 15 ALA n 1 16 PRO n 1 17 ILE n 1 18 PRO n 1 19 GLY n 1 20 THR n 1 21 PRO n 1 22 TRP n 1 23 CYS n 1 24 VAL n 1 25 VAL n 1 26 TRP n 1 27 THR n 1 28 GLY n 1 29 ASP n 1 30 GLU n 1 31 ARG n 1 32 VAL n 1 33 PHE n 1 34 PHE n 1 35 TYR n 1 36 ASN n 1 37 PRO n 1 38 THR n 1 39 THR n 1 40 ARG n 1 41 LEU n 1 42 SER n 1 43 MET n 1 44 TRP n 1 45 ASP n 1 46 ARG n 1 47 PRO n 1 48 ASP n 1 49 ASP n 1 50 LEU n 1 51 ILE n 1 52 GLY n 1 53 ARG n 1 54 ALA n 1 55 ASP n 1 56 VAL n 1 57 ASP n 1 58 LYS n 1 59 ILE n 1 60 ILE n 1 61 GLN n 1 62 GLU n 1 63 PRO n 1 64 PRO n 1 65 HIS n 1 66 LYS n 1 67 LYS n 1 68 SER n 1 69 GLY n 1 70 PRO n 1 71 SER n 1 72 SER n 1 73 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'TCERG1, CA150, TAF2S' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050822-13 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TCRG1_HUMAN _struct_ref.pdbx_db_accession O14776 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KAKPVATAPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKK _struct_ref.pdbx_align_begin 520 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DK7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14776 _struct_ref_seq.db_align_beg 520 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 579 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 67 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DK7 GLY A 1 ? UNP O14776 ? ? 'cloning artifact' 1 1 1 2DK7 SER A 2 ? UNP O14776 ? ? 'cloning artifact' 2 2 1 2DK7 SER A 3 ? UNP O14776 ? ? 'cloning artifact' 3 3 1 2DK7 GLY A 4 ? UNP O14776 ? ? 'cloning artifact' 4 4 1 2DK7 SER A 5 ? UNP O14776 ? ? 'cloning artifact' 5 5 1 2DK7 SER A 6 ? UNP O14776 ? ? 'cloning artifact' 6 6 1 2DK7 GLY A 7 ? UNP O14776 ? ? 'cloning artifact' 7 7 1 2DK7 SER A 68 ? UNP O14776 ? ? 'cloning artifact' 68 8 1 2DK7 GLY A 69 ? UNP O14776 ? ? 'cloning artifact' 69 9 1 2DK7 PRO A 70 ? UNP O14776 ? ? 'cloning artifact' 70 10 1 2DK7 SER A 71 ? UNP O14776 ? ? 'cloning artifact' 71 11 1 2DK7 SER A 72 ? UNP O14776 ? ? 'cloning artifact' 72 12 1 2DK7 GLY A 73 ? UNP O14776 ? ? 'cloning artifact' 73 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM U-15N, 13C; 20mM phosphate buffer NA; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90%H2O,10%D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DK7 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DK7 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DK7 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.9321 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # _exptl.entry_id 2DK7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DK7 _struct.title 'Solution structure of WW domain in transcription elongation regulator 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DK7 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;structural genomics, WW domain, Transcription elongation regulator 1, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 55 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 61 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 55 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 61 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 13 ? PRO A 16 ? ALA A 13 PRO A 16 A 2 CYS A 23 ? THR A 27 ? CYS A 23 THR A 27 A 3 VAL A 32 ? ASN A 36 ? VAL A 32 ASN A 36 A 4 LEU A 41 ? MET A 43 ? LEU A 41 MET A 43 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 13 ? N ALA A 13 O TRP A 26 ? O TRP A 26 A 2 3 N VAL A 25 ? N VAL A 25 O PHE A 33 ? O PHE A 33 A 3 4 N ASN A 36 ? N ASN A 36 O LEU A 41 ? O LEU A 41 # _database_PDB_matrix.entry_id 2DK7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DK7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 GLY 73 73 73 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-04-24 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX Determination method: Author determined ; 700 ;SHEET Determination method: Author determined ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -54.76 99.60 2 1 ALA A 9 ? ? -173.60 141.73 3 1 ASP A 29 ? ? -91.67 40.95 4 1 LYS A 66 ? ? -73.58 -73.21 5 1 LYS A 67 ? ? -55.17 177.80 6 2 SER A 5 ? ? 35.35 43.08 7 2 SER A 6 ? ? -122.19 -58.93 8 2 ASP A 29 ? ? -92.96 45.39 9 2 GLU A 30 ? ? 39.54 42.98 10 2 ASP A 49 ? ? -37.77 -27.72 11 2 PRO A 70 ? ? -69.86 2.79 12 2 SER A 72 ? ? -58.95 176.37 13 3 SER A 5 ? ? -101.00 50.12 14 3 LYS A 8 ? ? -56.72 97.15 15 3 ASP A 29 ? ? -86.92 41.44 16 3 ASP A 49 ? ? -39.29 -26.34 17 3 LYS A 66 ? ? -105.58 54.43 18 4 ASP A 29 ? ? -97.07 35.45 19 4 LYS A 67 ? ? -171.32 140.16 20 5 ASP A 29 ? ? -85.36 41.86 21 5 ASP A 49 ? ? -38.59 -26.33 22 5 LYS A 66 ? ? -118.54 53.97 23 5 LYS A 67 ? ? -173.43 145.71 24 6 SER A 2 ? ? -124.10 -61.08 25 6 ASP A 29 ? ? -93.45 43.31 26 7 ASP A 29 ? ? -94.18 31.65 27 7 HIS A 65 ? ? -48.29 -19.46 28 7 SER A 68 ? ? -46.91 166.78 29 8 SER A 6 ? ? -37.04 100.78 30 8 ASP A 29 ? ? -91.34 46.88 31 8 GLU A 30 ? ? 38.93 43.85 32 8 PRO A 70 ? ? -69.77 -175.74 33 9 SER A 2 ? ? -45.28 151.73 34 9 ASP A 29 ? ? -88.06 42.13 35 9 ASP A 49 ? ? -38.46 -26.54 36 9 LYS A 66 ? ? -102.61 50.40 37 10 ASP A 49 ? ? -38.43 -26.77 38 10 PRO A 70 ? ? -69.76 90.18 39 11 SER A 3 ? ? -40.45 157.38 40 11 ASP A 29 ? ? -90.50 49.84 41 11 GLU A 30 ? ? 35.95 44.68 42 11 ASP A 49 ? ? -39.87 -25.37 43 11 ILE A 51 ? ? -43.94 109.90 44 11 LYS A 67 ? ? -34.20 126.45 45 11 SER A 71 ? ? -103.95 40.06 46 12 LYS A 10 ? ? -39.96 139.37 47 12 ASP A 29 ? ? -89.88 46.51 48 12 GLU A 30 ? ? 38.26 43.69 49 12 ASP A 49 ? ? -38.90 -26.08 50 12 LYS A 67 ? ? -56.77 101.92 51 13 ASP A 29 ? ? -92.76 46.83 52 13 GLU A 30 ? ? 38.81 43.37 53 13 ASP A 49 ? ? -38.56 -26.45 54 14 ASP A 29 ? ? -91.12 46.25 55 14 GLU A 30 ? ? 39.06 39.34 56 14 ASP A 49 ? ? -38.56 -28.64 57 14 SER A 71 ? ? -35.08 115.46 58 15 ASP A 29 ? ? -87.34 44.53 59 15 GLU A 30 ? ? 39.88 41.88 60 15 ARG A 40 ? ? 38.93 36.98 61 15 SER A 71 ? ? -165.26 109.59 62 16 VAL A 24 ? ? -68.44 93.30 63 16 ASP A 29 ? ? -89.67 41.86 64 16 ASP A 49 ? ? -38.52 -26.32 65 16 LYS A 67 ? ? -38.63 100.72 66 17 ASP A 29 ? ? -88.19 48.44 67 17 GLU A 30 ? ? 34.94 45.61 68 18 ASP A 29 ? ? -86.12 41.64 69 18 ASP A 49 ? ? -38.59 -26.44 70 19 LYS A 8 ? ? 32.53 42.90 71 19 ASP A 29 ? ? -90.29 42.25 72 19 ASP A 49 ? ? -38.42 -26.75 73 19 ILE A 59 ? ? -36.82 -39.47 74 19 LYS A 67 ? ? -173.28 128.13 75 20 ALA A 9 ? ? -39.44 104.74 76 20 ASP A 29 ? ? -96.04 47.79 77 20 GLU A 30 ? ? 37.07 44.90 78 20 ASP A 49 ? ? -38.24 -28.51 79 20 LYS A 67 ? ? -35.87 127.39 #