data_2DKZ # _entry.id 2DKZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DKZ pdb_00002dkz 10.2210/pdb2dkz/pdb RCSB RCSB025539 ? ? WWPDB D_1000025539 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001001067.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DKZ _pdbx_database_status.recvd_initial_deposition_date 2006-04-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Goroncy, A.K.' 1 'Sato, M.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the SAM_PNT-domain of the hypothetical protein LOC64762' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Goroncy, A.K.' 1 ? primary 'Sato, M.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _cell.entry_id 2DKZ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2DKZ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'hypothetical protein LOC64762' _entity.formula_weight 9009.144 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sam_pnt domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGPWQPPADLSGLSIEEVSKSLRFIGLSEDVISFFVTEKIDGNLLVQLTEEILSEDFKLSKLQVKKIMQFINGSG PSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGPWQPPADLSGLSIEEVSKSLRFIGLSEDVISFFVTEKIDGNLLVQLTEEILSEDFKLSKLQVKKIMQFINGSG PSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001001067.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 TRP n 1 10 GLN n 1 11 PRO n 1 12 PRO n 1 13 ALA n 1 14 ASP n 1 15 LEU n 1 16 SER n 1 17 GLY n 1 18 LEU n 1 19 SER n 1 20 ILE n 1 21 GLU n 1 22 GLU n 1 23 VAL n 1 24 SER n 1 25 LYS n 1 26 SER n 1 27 LEU n 1 28 ARG n 1 29 PHE n 1 30 ILE n 1 31 GLY n 1 32 LEU n 1 33 SER n 1 34 GLU n 1 35 ASP n 1 36 VAL n 1 37 ILE n 1 38 SER n 1 39 PHE n 1 40 PHE n 1 41 VAL n 1 42 THR n 1 43 GLU n 1 44 LYS n 1 45 ILE n 1 46 ASP n 1 47 GLY n 1 48 ASN n 1 49 LEU n 1 50 LEU n 1 51 VAL n 1 52 GLN n 1 53 LEU n 1 54 THR n 1 55 GLU n 1 56 GLU n 1 57 ILE n 1 58 LEU n 1 59 SER n 1 60 GLU n 1 61 ASP n 1 62 PHE n 1 63 LYS n 1 64 LEU n 1 65 SER n 1 66 LYS n 1 67 LEU n 1 68 GLN n 1 69 VAL n 1 70 LYS n 1 71 LYS n 1 72 ILE n 1 73 MET n 1 74 GLN n 1 75 PHE n 1 76 ILE n 1 77 ASN n 1 78 GLY n 1 79 SER n 1 80 GLY n 1 81 PRO n 1 82 SER n 1 83 SER n 1 84 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene COL07333 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050822-11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'CELL-FREE PROTEIN SYNTHESIS' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9BSF5_HUMAN _struct_ref.pdbx_db_accession Q9BSF5 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 702 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DKZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 78 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9BSF5 _struct_ref_seq.db_align_beg 702 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 772 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 78 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DKZ GLY A 1 ? UNP Q9BSF5 ? ? 'cloning artifact' 1 1 1 2DKZ SER A 2 ? UNP Q9BSF5 ? ? 'cloning artifact' 2 2 1 2DKZ SER A 3 ? UNP Q9BSF5 ? ? 'cloning artifact' 3 3 1 2DKZ GLY A 4 ? UNP Q9BSF5 ? ? 'cloning artifact' 4 4 1 2DKZ SER A 5 ? UNP Q9BSF5 ? ? 'cloning artifact' 5 5 1 2DKZ SER A 6 ? UNP Q9BSF5 ? ? 'cloning artifact' 6 6 1 2DKZ GLY A 7 ? UNP Q9BSF5 ? ? 'cloning artifact' 7 7 1 2DKZ SER A 79 ? UNP Q9BSF5 ? ? 'cloning artifact' 79 8 1 2DKZ GLY A 80 ? UNP Q9BSF5 ? ? 'cloning artifact' 80 9 1 2DKZ PRO A 81 ? UNP Q9BSF5 ? ? 'cloning artifact' 81 10 1 2DKZ SER A 82 ? UNP Q9BSF5 ? ? 'cloning artifact' 82 11 1 2DKZ SER A 83 ? UNP Q9BSF5 ? ? 'cloning artifact' 83 12 1 2DKZ GLY A 84 ? UNP Q9BSF5 ? ? 'cloning artifact' 84 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.13mM SAM_PNT DOMAIN, 20mM d-TRIS-HCL, 100mM NaCl, 1mM d-DTT, 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DKZ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DKZ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DKZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CYANA 2.2.1 'P.GUNTERT ET AL.' 1 'structure solution' CYANA 2.2.1 'P.GUNTERT ET AL.' 2 collection XwinNMR 3.5 BRUKER 3 processing NMRPipe 20031121 'FRANK DELAGLIO' 4 'data analysis' NMRView 5.0.4 'BRUCE A. JOHNSON' 5 'data analysis' KUJIRA 0.899a 'NAOHIRO KOBAYASHI' 6 # _exptl.entry_id 2DKZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DKZ _struct.title 'Solution structure of the SAM_PNT-domain of the hypothetical protein LOC64762' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DKZ _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;CELL-FREE PROTEIN SYNTHESIS, PROTEIN REGULATION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 19 ? LEU A 27 ? SER A 19 LEU A 27 1 ? 9 HELX_P HELX_P2 2 ARG A 28 ? ILE A 30 ? ARG A 28 ILE A 30 5 ? 3 HELX_P HELX_P3 3 SER A 33 ? THR A 42 ? SER A 33 THR A 42 1 ? 10 HELX_P HELX_P4 4 ASP A 46 ? LEU A 53 ? ASP A 46 LEU A 53 1 ? 8 HELX_P HELX_P5 5 THR A 54 ? ASP A 61 ? THR A 54 ASP A 61 1 ? 8 HELX_P HELX_P6 6 SER A 65 ? GLY A 78 ? SER A 65 GLY A 78 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2DKZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DKZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? 62.98 -178.91 2 1 PRO A 12 ? ? -69.77 -172.55 3 1 SER A 16 ? ? -109.00 73.73 4 1 ASP A 61 ? ? -76.70 -72.82 5 1 SER A 83 ? ? 55.24 75.06 6 2 SER A 2 ? ? -164.75 84.59 7 2 LEU A 15 ? ? -97.24 32.63 8 2 ASP A 61 ? ? -76.00 -73.67 9 2 PRO A 81 ? ? -69.79 81.00 10 3 SER A 6 ? ? -93.09 -62.96 11 3 PRO A 12 ? ? -69.74 -178.19 12 3 ASP A 61 ? ? -81.63 -73.74 13 4 SER A 2 ? ? 59.60 -174.54 14 4 SER A 3 ? ? -81.78 -72.69 15 4 SER A 6 ? ? -171.42 90.39 16 4 PRO A 12 ? ? -69.78 -177.16 17 4 ASP A 14 ? ? -138.30 -42.40 18 4 SER A 16 ? ? -113.51 75.94 19 4 LEU A 64 ? ? -59.98 178.38 20 4 PRO A 81 ? ? -69.79 90.65 21 4 SER A 82 ? ? -166.21 61.94 22 5 SER A 6 ? ? -94.25 45.47 23 5 PRO A 12 ? ? -69.72 -175.31 24 5 ASP A 61 ? ? -83.17 -74.55 25 5 SER A 82 ? ? 56.09 77.07 26 6 SER A 3 ? ? -121.44 -50.37 27 6 PRO A 12 ? ? -69.71 -178.62 28 6 ASP A 14 ? ? -137.34 -42.31 29 6 ASP A 61 ? ? -76.71 -73.82 30 6 LEU A 64 ? ? -61.16 -179.37 31 6 SER A 79 ? ? -59.13 101.56 32 6 PRO A 81 ? ? -69.70 -171.05 33 6 SER A 83 ? ? -145.56 -60.87 34 7 SER A 2 ? ? 57.88 88.17 35 7 PRO A 12 ? ? -69.78 -175.19 36 7 LEU A 15 ? ? -93.16 43.25 37 7 ASP A 61 ? ? -81.52 -74.44 38 7 SER A 83 ? ? 60.88 174.85 39 8 SER A 5 ? ? -140.59 -67.53 40 8 ASP A 61 ? ? -73.87 -73.97 41 8 PRO A 81 ? ? -69.81 99.35 42 9 SER A 3 ? ? -155.87 -59.57 43 10 SER A 3 ? ? -138.53 -42.48 44 10 PRO A 12 ? ? -69.75 -177.01 45 10 ASP A 61 ? ? -85.94 -72.67 46 10 LEU A 64 ? ? -66.76 -179.86 47 10 PRO A 81 ? ? -69.72 80.62 48 10 SER A 83 ? ? 60.75 65.20 49 11 PRO A 12 ? ? -69.77 -179.86 50 11 ASP A 14 ? ? -134.39 -41.54 51 11 ASP A 61 ? ? -80.23 -74.41 52 11 PRO A 81 ? ? -69.73 84.07 53 11 SER A 83 ? ? 62.76 103.14 54 12 PRO A 12 ? ? -69.77 -176.55 55 12 ASP A 61 ? ? -89.76 -71.32 56 12 SER A 82 ? ? -96.68 -70.50 57 13 SER A 6 ? ? -113.46 63.92 58 13 ASP A 61 ? ? -83.30 -73.66 59 13 PRO A 81 ? ? -69.78 88.62 60 14 SER A 2 ? ? -83.14 -70.42 61 14 SER A 5 ? ? 59.40 -171.05 62 14 ASP A 14 ? ? -140.95 -43.36 63 14 ASP A 46 ? ? -120.92 -169.97 64 14 ASP A 61 ? ? -73.10 -73.37 65 14 SER A 79 ? ? -58.23 105.79 66 14 SER A 82 ? ? 53.42 87.53 67 15 SER A 3 ? ? -154.93 -57.78 68 15 PRO A 12 ? ? -69.81 -174.50 69 15 ASP A 61 ? ? -83.30 -73.78 70 15 LEU A 64 ? ? -61.56 -179.28 71 16 PRO A 12 ? ? -69.76 -179.92 72 16 ASP A 14 ? ? -132.90 -43.81 73 16 ASP A 61 ? ? -80.51 -73.75 74 16 SER A 82 ? ? -160.58 110.77 75 17 SER A 5 ? ? 60.14 -177.31 76 17 SER A 6 ? ? -125.46 -67.78 77 17 LEU A 15 ? ? -99.44 38.19 78 17 SER A 16 ? ? -112.47 75.79 79 17 ASP A 61 ? ? -77.84 -70.59 80 17 SER A 83 ? ? 62.76 65.16 81 18 SER A 3 ? ? -114.62 73.27 82 18 PRO A 12 ? ? -69.74 -178.23 83 18 ASP A 61 ? ? -80.47 -71.50 84 18 LEU A 64 ? ? -67.75 -177.54 85 18 PRO A 81 ? ? -69.71 -171.24 86 18 SER A 83 ? ? -176.95 143.73 87 19 SER A 3 ? ? -143.32 37.92 88 19 LEU A 15 ? ? -99.13 37.21 89 19 ASP A 61 ? ? -81.46 -74.29 90 19 PRO A 81 ? ? -69.76 88.24 91 20 SER A 2 ? ? 61.58 169.29 92 20 PRO A 12 ? ? -69.81 -177.49 93 20 LEU A 15 ? ? -94.74 40.39 94 20 ASP A 61 ? ? -75.58 -73.94 95 20 SER A 82 ? ? -154.29 -52.44 96 20 SER A 83 ? ? 63.05 -171.09 #