data_2DLO # _entry.id 2DLO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DLO pdb_00002dlo 10.2210/pdb2dlo/pdb RCSB RCSB025559 ? ? WWPDB D_1000025559 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1X61 'The other region of the same protein' unspecified TargetDB hsi002005302.2 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DLO _pdbx_database_status.recvd_initial_deposition_date 2006-04-20 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the second LIM domain of human Thyroid receptor-interacting protein 6' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thyroid receptor-interacting protein 6' 8548.713 1 ? ? 'LIM domain, LIM zinc-binding 2' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TRIP6, OPA-interacting protein 1, Zyxin-related protein 1, ZRP-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFASGPSS G ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFASGPSS G ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002005302.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 GLY n 1 10 CYS n 1 11 TYR n 1 12 VAL n 1 13 ALA n 1 14 THR n 1 15 LEU n 1 16 GLU n 1 17 LYS n 1 18 CYS n 1 19 ALA n 1 20 THR n 1 21 CYS n 1 22 SER n 1 23 GLN n 1 24 PRO n 1 25 ILE n 1 26 LEU n 1 27 ASP n 1 28 ARG n 1 29 ILE n 1 30 LEU n 1 31 ARG n 1 32 ALA n 1 33 MET n 1 34 GLY n 1 35 LYS n 1 36 ALA n 1 37 TYR n 1 38 HIS n 1 39 PRO n 1 40 GLY n 1 41 CYS n 1 42 PHE n 1 43 THR n 1 44 CYS n 1 45 VAL n 1 46 VAL n 1 47 CYS n 1 48 HIS n 1 49 ARG n 1 50 GLY n 1 51 LEU n 1 52 ASP n 1 53 GLY n 1 54 ILE n 1 55 PRO n 1 56 PHE n 1 57 THR n 1 58 VAL n 1 59 ASP n 1 60 ALA n 1 61 THR n 1 62 SER n 1 63 GLN n 1 64 ILE n 1 65 HIS n 1 66 CYS n 1 67 ILE n 1 68 GLU n 1 69 ASP n 1 70 PHE n 1 71 HIS n 1 72 ARG n 1 73 LYS n 1 74 PHE n 1 75 ALA n 1 76 SER n 1 77 GLY n 1 78 PRO n 1 79 SER n 1 80 SER n 1 81 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'TRIP6, OIP1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041101-03 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRIP6_HUMAN _struct_ref.pdbx_db_accession Q15654 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 329 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DLO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q15654 _struct_ref_seq.db_align_beg 329 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 396 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DLO GLY A 1 ? UNP Q15654 ? ? 'cloning artifact' 1 1 1 2DLO SER A 2 ? UNP Q15654 ? ? 'cloning artifact' 2 2 1 2DLO SER A 3 ? UNP Q15654 ? ? 'cloning artifact' 3 3 1 2DLO GLY A 4 ? UNP Q15654 ? ? 'cloning artifact' 4 4 1 2DLO SER A 5 ? UNP Q15654 ? ? 'cloning artifact' 5 5 1 2DLO SER A 6 ? UNP Q15654 ? ? 'cloning artifact' 6 6 1 2DLO GLY A 7 ? UNP Q15654 ? ? 'cloning artifact' 7 7 1 2DLO SER A 76 ? UNP Q15654 ? ? 'cloning artifact' 76 8 1 2DLO GLY A 77 ? UNP Q15654 ? ? 'cloning artifact' 77 9 1 2DLO PRO A 78 ? UNP Q15654 ? ? 'cloning artifact' 78 10 1 2DLO SER A 79 ? UNP Q15654 ? ? 'cloning artifact' 79 11 1 2DLO SER A 80 ? UNP Q15654 ? ? 'cloning artifact' 80 12 1 2DLO GLY A 81 ? UNP Q15654 ? ? 'cloning artifact' 81 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.54mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.25mM ZnCl2+1mMIDA; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DLO _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DLO _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DLO _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A' 3 'data analysis' KUJIRA 0.9296 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DLO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DLO _struct.title 'Solution structure of the second LIM domain of human Thyroid receptor-interacting protein 6' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DLO _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text ;LIM domain, Thyroid receptor interacting protein 6 (TRIP6), OPA-interacting protein 1, Zyxin related protein 1 (ZRP-1), Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, cell adhesion ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ILE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 67 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 74 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ILE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 67 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 74 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.388 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.292 ? ? metalc3 metalc ? ? A HIS 38 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 38 A ZN 201 1_555 ? ? ? ? ? ? ? 2.075 ? ? metalc4 metalc ? ? A CYS 41 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 41 A ZN 201 1_555 ? ? ? ? ? ? ? 2.245 ? ? metalc5 metalc ? ? A CYS 44 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 44 A ZN 401 1_555 ? ? ? ? ? ? ? 2.305 ? ? metalc6 metalc ? ? A CYS 47 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 47 A ZN 401 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc7 metalc ? ? A CYS 66 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 66 A ZN 401 1_555 ? ? ? ? ? ? ? 2.249 ? ? metalc8 metalc ? ? A ASP 69 OD1 ? ? ? 1_555 C ZN . ZN ? ? A ASP 69 A ZN 401 1_555 ? ? ? ? ? ? ? 3.088 ? ? metalc9 metalc ? ? A ASP 69 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 69 A ZN 401 1_555 ? ? ? ? ? ? ? 2.050 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 30 ? ALA A 32 ? LEU A 30 ALA A 32 A 2 LYS A 35 ? TYR A 37 ? LYS A 35 TYR A 37 B 1 PHE A 56 ? THR A 57 ? PHE A 56 THR A 57 B 2 HIS A 65 ? CYS A 66 ? HIS A 65 CYS A 66 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 30 ? N LEU A 30 O TYR A 37 ? O TYR A 37 B 1 2 N THR A 57 ? N THR A 57 O HIS A 65 ? O HIS A 65 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 HIS A 38 ? HIS A 38 . ? 1_555 ? 4 AC1 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 5 AC2 4 CYS A 44 ? CYS A 44 . ? 1_555 ? 6 AC2 4 CYS A 47 ? CYS A 47 . ? 1_555 ? 7 AC2 4 CYS A 66 ? CYS A 66 . ? 1_555 ? 8 AC2 4 ASP A 69 ? ASP A 69 . ? 1_555 ? # _database_PDB_matrix.entry_id 2DLO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DLO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLY 81 81 81 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 104.2 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 38 ? A HIS 38 ? 1_555 102.3 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 38 ? A HIS 38 ? 1_555 105.4 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 112.4 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 116.5 ? 6 ND1 ? A HIS 38 ? A HIS 38 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 114.6 ? 7 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 47 ? A CYS 47 ? 1_555 103.7 ? 8 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 66 ? A CYS 66 ? 1_555 112.9 ? 9 SG ? A CYS 47 ? A CYS 47 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 66 ? A CYS 66 ? 1_555 105.1 ? 10 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 OD1 ? A ASP 69 ? A ASP 69 ? 1_555 153.2 ? 11 SG ? A CYS 47 ? A CYS 47 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 OD1 ? A ASP 69 ? A ASP 69 ? 1_555 101.7 ? 12 SG ? A CYS 66 ? A CYS 66 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 OD1 ? A ASP 69 ? A ASP 69 ? 1_555 68.2 ? 13 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 OD2 ? A ASP 69 ? A ASP 69 ? 1_555 116.2 ? 14 SG ? A CYS 47 ? A CYS 47 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 OD2 ? A ASP 69 ? A ASP 69 ? 1_555 109.4 ? 15 SG ? A CYS 66 ? A CYS 66 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 OD2 ? A ASP 69 ? A ASP 69 ? 1_555 108.9 ? 16 OD1 ? A ASP 69 ? A ASP 69 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 OD2 ? A ASP 69 ? A ASP 69 ? 1_555 45.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-20 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 4 'Structure model' '_struct_ref_seq_dif.details' 17 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -164.28 111.27 2 1 GLU A 8 ? ? -67.58 80.67 3 1 THR A 14 ? ? 32.04 46.68 4 1 ASP A 27 ? ? -66.47 -70.25 5 1 PRO A 39 ? ? -69.73 3.74 6 1 PHE A 42 ? ? -55.17 107.90 7 1 VAL A 46 ? ? -90.77 -70.59 8 1 ILE A 64 ? ? -39.23 112.06 9 1 ALA A 75 ? ? -95.14 56.04 10 2 ALA A 13 ? ? -174.58 -177.92 11 2 THR A 14 ? ? -68.56 84.35 12 2 LEU A 26 ? ? -130.52 -42.98 13 2 PRO A 39 ? ? -69.72 3.71 14 2 PHE A 42 ? ? -53.78 98.99 15 2 VAL A 46 ? ? -97.21 -74.02 16 2 LEU A 51 ? ? -90.74 44.85 17 2 THR A 61 ? ? -90.04 31.79 18 2 PRO A 78 ? ? -69.77 -177.36 19 3 CYS A 10 ? ? -111.43 74.11 20 3 PRO A 39 ? ? -69.87 4.66 21 3 VAL A 46 ? ? -93.75 -73.46 22 3 ASP A 59 ? ? -127.40 -75.14 23 3 ALA A 60 ? ? -134.61 -50.41 24 3 THR A 61 ? ? -84.83 33.35 25 3 SER A 62 ? ? 36.64 36.50 26 3 ILE A 64 ? ? -34.41 103.09 27 3 ALA A 75 ? ? -108.91 67.09 28 3 SER A 79 ? ? -174.72 137.18 29 4 THR A 14 ? ? -68.76 80.16 30 4 PRO A 39 ? ? -69.78 3.88 31 4 PHE A 42 ? ? -51.64 100.17 32 4 CYS A 44 ? ? -49.29 163.91 33 4 VAL A 46 ? ? -97.94 -72.15 34 4 LEU A 51 ? ? -97.01 37.97 35 4 ILE A 64 ? ? -58.69 107.63 36 4 PRO A 78 ? ? -69.73 -173.64 37 5 LEU A 26 ? ? -132.67 -41.51 38 5 PRO A 39 ? ? -69.77 3.78 39 5 PHE A 42 ? ? -50.78 106.94 40 5 VAL A 46 ? ? -97.66 -73.21 41 5 THR A 61 ? ? -91.89 32.51 42 5 SER A 62 ? ? 38.00 38.02 43 5 HIS A 71 ? ? -84.10 -70.27 44 5 ARG A 72 ? ? -37.88 -39.69 45 6 CYS A 10 ? ? -170.12 128.72 46 6 ALA A 13 ? ? -175.21 108.10 47 6 THR A 14 ? ? 32.37 51.83 48 6 SER A 22 ? ? 70.65 50.00 49 6 ASP A 27 ? ? -68.28 -74.83 50 6 PRO A 39 ? ? -69.71 3.55 51 6 PHE A 42 ? ? -56.87 107.46 52 6 VAL A 46 ? ? -94.57 -71.37 53 6 LEU A 51 ? ? -102.54 41.82 54 6 SER A 76 ? ? 38.44 42.91 55 7 ALA A 13 ? ? -174.80 -176.55 56 7 THR A 14 ? ? -81.73 46.36 57 7 ASP A 27 ? ? -69.17 -72.53 58 7 PRO A 39 ? ? -69.74 3.65 59 7 PHE A 42 ? ? -52.53 105.13 60 7 VAL A 46 ? ? -95.19 -74.33 61 7 LEU A 51 ? ? -88.63 35.23 62 7 ALA A 60 ? ? -37.58 -39.77 63 7 THR A 61 ? ? -89.14 37.44 64 7 SER A 62 ? ? 34.36 42.92 65 8 CYS A 10 ? ? -82.95 43.16 66 8 PRO A 39 ? ? -69.80 3.88 67 8 PHE A 42 ? ? -50.88 103.88 68 8 VAL A 46 ? ? -95.86 -73.01 69 8 THR A 57 ? ? -170.18 146.75 70 8 ASP A 59 ? ? -127.82 -75.50 71 8 ALA A 60 ? ? -134.80 -60.28 72 8 SER A 62 ? ? 73.92 31.53 73 8 ILE A 64 ? ? -33.32 110.03 74 8 ALA A 75 ? ? -81.89 39.08 75 9 SER A 6 ? ? -166.05 116.37 76 9 TYR A 11 ? ? -53.64 171.66 77 9 THR A 14 ? ? -68.78 79.47 78 9 ASP A 27 ? ? -60.70 -71.80 79 9 PRO A 39 ? ? -69.79 3.84 80 9 PHE A 42 ? ? -54.75 97.78 81 9 VAL A 46 ? ? -95.73 -74.01 82 9 LEU A 51 ? ? -97.43 33.77 83 9 THR A 61 ? ? -89.22 36.96 84 9 SER A 62 ? ? 38.11 39.82 85 9 ILE A 64 ? ? -60.61 96.56 86 10 ALA A 13 ? ? -174.76 -179.29 87 10 MET A 33 ? ? 43.09 25.86 88 10 PRO A 39 ? ? -69.76 2.31 89 10 THR A 57 ? ? -175.33 142.57 90 10 ASP A 59 ? ? -125.61 -75.74 91 10 ALA A 60 ? ? -134.39 -46.83 92 10 THR A 61 ? ? -86.02 36.44 93 10 SER A 62 ? ? 35.49 33.57 94 10 ILE A 64 ? ? -42.80 106.20 95 10 HIS A 71 ? ? -73.50 -70.18 96 10 SER A 76 ? ? 36.75 42.13 97 11 GLU A 8 ? ? -132.55 -44.94 98 11 CYS A 10 ? ? -37.25 126.60 99 11 ALA A 13 ? ? -174.90 105.01 100 11 THR A 14 ? ? 31.89 52.38 101 11 THR A 20 ? ? -109.81 -62.25 102 11 ASP A 27 ? ? -59.92 -73.58 103 11 PRO A 39 ? ? -69.77 3.30 104 11 PHE A 42 ? ? -59.66 101.99 105 11 VAL A 46 ? ? -94.23 -73.35 106 11 ILE A 64 ? ? -40.77 107.60 107 11 PHE A 70 ? ? -37.84 -34.14 108 12 SER A 5 ? ? -174.90 138.91 109 12 CYS A 10 ? ? -130.26 -60.29 110 12 ALA A 13 ? ? -170.56 -176.19 111 12 ASP A 27 ? ? -61.54 -70.35 112 12 PRO A 39 ? ? -69.74 4.02 113 12 PHE A 42 ? ? -51.50 102.47 114 12 VAL A 46 ? ? -94.23 -74.02 115 12 LEU A 51 ? ? -95.41 41.24 116 12 ILE A 64 ? ? -56.09 103.71 117 12 ALA A 75 ? ? -92.52 45.08 118 13 THR A 14 ? ? -77.43 47.99 119 13 SER A 22 ? ? 72.86 46.00 120 13 ASP A 27 ? ? -67.25 -74.67 121 13 PRO A 39 ? ? -69.77 3.41 122 13 PHE A 42 ? ? -52.67 95.95 123 13 VAL A 46 ? ? -95.59 -72.70 124 13 ILE A 64 ? ? -34.89 109.10 125 14 VAL A 12 ? ? -34.82 150.63 126 14 SER A 22 ? ? 73.97 46.57 127 14 ASP A 27 ? ? -64.50 -71.55 128 14 PRO A 39 ? ? -69.73 3.34 129 14 VAL A 46 ? ? -101.65 -65.86 130 14 THR A 61 ? ? -93.33 36.14 131 14 SER A 62 ? ? 34.15 41.69 132 15 THR A 14 ? ? -67.55 83.43 133 15 PRO A 39 ? ? -69.83 4.63 134 15 PHE A 42 ? ? -52.67 99.41 135 15 VAL A 46 ? ? -91.55 -70.01 136 15 LEU A 51 ? ? -98.04 42.61 137 15 THR A 61 ? ? -89.81 37.47 138 15 SER A 62 ? ? 34.56 45.18 139 15 ILE A 64 ? ? -51.55 104.25 140 15 ALA A 75 ? ? -103.18 45.83 141 16 ALA A 13 ? ? -174.90 -178.06 142 16 THR A 14 ? ? -65.55 80.98 143 16 PRO A 39 ? ? -69.76 3.12 144 16 PHE A 42 ? ? -51.04 101.53 145 16 VAL A 46 ? ? -95.36 -69.95 146 16 LEU A 51 ? ? -90.02 44.86 147 17 ALA A 13 ? ? -170.94 -178.14 148 17 THR A 14 ? ? -75.69 49.65 149 17 ASP A 27 ? ? -66.58 -75.24 150 17 PRO A 39 ? ? -69.72 4.35 151 17 PHE A 42 ? ? -53.51 106.15 152 17 VAL A 46 ? ? -95.74 -68.20 153 17 LEU A 51 ? ? -97.54 39.27 154 17 THR A 61 ? ? -87.62 34.95 155 17 SER A 62 ? ? 36.07 36.65 156 17 ILE A 64 ? ? -58.40 104.34 157 17 PRO A 78 ? ? -69.73 95.69 158 18 GLU A 8 ? ? -92.79 43.70 159 18 ALA A 13 ? ? -170.56 -175.16 160 18 PRO A 39 ? ? -69.66 3.52 161 18 PHE A 42 ? ? -50.65 98.07 162 18 VAL A 46 ? ? -105.09 -75.14 163 18 LEU A 51 ? ? -96.97 42.91 164 18 THR A 61 ? ? -88.10 32.94 165 18 SER A 62 ? ? 39.63 41.19 166 18 ILE A 64 ? ? -60.48 94.29 167 19 ALA A 13 ? ? -171.94 -176.96 168 19 THR A 14 ? ? -69.92 78.42 169 19 SER A 22 ? ? 70.04 50.57 170 19 LEU A 26 ? ? -131.28 -42.33 171 19 PRO A 39 ? ? -69.77 3.51 172 19 VAL A 46 ? ? -93.21 -72.32 173 19 ASP A 59 ? ? -127.69 -75.29 174 19 ALA A 60 ? ? -133.41 -52.19 175 19 THR A 61 ? ? -85.88 34.20 176 19 SER A 62 ? ? 39.13 34.18 177 19 ILE A 64 ? ? -38.49 100.51 178 19 ALA A 75 ? ? -57.91 172.23 179 19 SER A 76 ? ? -55.53 109.06 180 19 SER A 80 ? ? -43.51 152.51 181 20 THR A 14 ? ? -48.93 -18.35 182 20 LEU A 26 ? ? -133.08 -44.52 183 20 PRO A 39 ? ? -69.72 3.70 184 20 PHE A 42 ? ? -54.33 108.99 185 20 VAL A 46 ? ? -97.43 -72.69 186 20 LEU A 51 ? ? -100.84 40.04 187 20 THR A 61 ? ? -92.94 32.27 188 20 SER A 62 ? ? 34.94 42.31 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #