data_2DLV # _entry.id 2DLV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DLV pdb_00002dlv 10.2210/pdb2dlv/pdb RCSB RCSB025566 ? ? WWPDB D_1000025566 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002012138.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DLV _pdbx_database_status.recvd_initial_deposition_date 2006-04-20 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, H.P.' 1 'Suetake, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the RGS domain of human regulator of G-protein signaling 18' _citation.journal_abbrev 'to be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, H.P.' 1 ? primary 'Suetake, T.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Regulator of G-protein signaling 18' _entity.formula_weight 15911.692 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RGS domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name RGS18 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAP KEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAP KEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002012138.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 PRO n 1 10 GLU n 1 11 GLU n 1 12 ALA n 1 13 VAL n 1 14 LYS n 1 15 TRP n 1 16 GLY n 1 17 GLU n 1 18 SER n 1 19 PHE n 1 20 ASP n 1 21 LYS n 1 22 LEU n 1 23 LEU n 1 24 SER n 1 25 HIS n 1 26 ARG n 1 27 ASP n 1 28 GLY n 1 29 LEU n 1 30 GLU n 1 31 ALA n 1 32 PHE n 1 33 THR n 1 34 ARG n 1 35 PHE n 1 36 LEU n 1 37 LYS n 1 38 THR n 1 39 GLU n 1 40 PHE n 1 41 SER n 1 42 GLU n 1 43 GLU n 1 44 ASN n 1 45 ILE n 1 46 GLU n 1 47 PHE n 1 48 TRP n 1 49 ILE n 1 50 ALA n 1 51 CYS n 1 52 GLU n 1 53 ASP n 1 54 PHE n 1 55 LYS n 1 56 LYS n 1 57 SER n 1 58 LYS n 1 59 GLY n 1 60 PRO n 1 61 GLN n 1 62 GLN n 1 63 ILE n 1 64 HIS n 1 65 LEU n 1 66 LYS n 1 67 ALA n 1 68 LYS n 1 69 ALA n 1 70 ILE n 1 71 TYR n 1 72 GLU n 1 73 LYS n 1 74 PHE n 1 75 ILE n 1 76 GLN n 1 77 THR n 1 78 ASP n 1 79 ALA n 1 80 PRO n 1 81 LYS n 1 82 GLU n 1 83 VAL n 1 84 ASN n 1 85 LEU n 1 86 ASP n 1 87 PHE n 1 88 HIS n 1 89 THR n 1 90 LYS n 1 91 GLU n 1 92 VAL n 1 93 ILE n 1 94 THR n 1 95 ASN n 1 96 SER n 1 97 ILE n 1 98 THR n 1 99 GLN n 1 100 PRO n 1 101 THR n 1 102 LEU n 1 103 HIS n 1 104 SER n 1 105 PHE n 1 106 ASP n 1 107 ALA n 1 108 ALA n 1 109 GLN n 1 110 SER n 1 111 ARG n 1 112 VAL n 1 113 TYR n 1 114 GLN n 1 115 LEU n 1 116 MET n 1 117 GLU n 1 118 GLN n 1 119 ASP n 1 120 SER n 1 121 TYR n 1 122 THR n 1 123 ARG n 1 124 PHE n 1 125 LEU n 1 126 LYS n 1 127 SER n 1 128 ASP n 1 129 ILE n 1 130 TYR n 1 131 LEU n 1 132 ASP n 1 133 LEU n 1 134 MET n 1 135 SER n 1 136 GLY n 1 137 PRO n 1 138 SER n 1 139 SER n 1 140 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'RGS18, RGS13' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050627-05 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RGS18_HUMAN _struct_ref.pdbx_db_accession Q9NS28 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDF HTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLM ; _struct_ref.pdbx_align_begin 76 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DLV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NS28 _struct_ref_seq.db_align_beg 76 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 202 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 134 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DLV GLY A 1 ? UNP Q9NS28 ? ? 'cloning artifact' 1 1 1 2DLV SER A 2 ? UNP Q9NS28 ? ? 'cloning artifact' 2 2 1 2DLV SER A 3 ? UNP Q9NS28 ? ? 'cloning artifact' 3 3 1 2DLV GLY A 4 ? UNP Q9NS28 ? ? 'cloning artifact' 4 4 1 2DLV SER A 5 ? UNP Q9NS28 ? ? 'cloning artifact' 5 5 1 2DLV SER A 6 ? UNP Q9NS28 ? ? 'cloning artifact' 6 6 1 2DLV GLY A 7 ? UNP Q9NS28 ? ? 'cloning artifact' 7 7 1 2DLV SER A 135 ? UNP Q9NS28 ? ? 'cloning artifact' 135 8 1 2DLV GLY A 136 ? UNP Q9NS28 ? ? 'cloning artifact' 136 9 1 2DLV PRO A 137 ? UNP Q9NS28 ? ? 'cloning artifact' 137 10 1 2DLV SER A 138 ? UNP Q9NS28 ? ? 'cloning artifact' 138 11 1 2DLV SER A 139 ? UNP Q9NS28 ? ? 'cloning artifact' 139 12 1 2DLV GLY A 140 ? UNP Q9NS28 ? ? 'cloning artifact' 140 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.22 mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02%NaN3, 90%H2O; 10%D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DLV _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2DLV _pdbx_nmr_details.text 'spectrometer_id 1 for 3D_15N_separated_NOESY; spectrometer_id 2 for 3D_13C_separated_NOESY' # _pdbx_nmr_ensemble.entry_id 2DLV _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DLV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.04 Johnson,B.A. 3 'data analysis' KUJIRA 0.93191 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntent,P. 5 refinement CYANA 2.0.17 Guntent,P. 6 # _exptl.entry_id 2DLV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DLV _struct.title 'Solution structure of the RGS domain of human regulator of G-protein signaling 18' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DLV _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;RGS domain, Regulator of G-protein signaling 18, RGS18, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 10 ? TRP A 15 ? GLU A 10 TRP A 15 1 ? 6 HELX_P HELX_P2 2 PHE A 19 ? SER A 24 ? PHE A 19 SER A 24 1 ? 6 HELX_P HELX_P3 3 ARG A 26 ? THR A 38 ? ARG A 26 THR A 38 1 ? 13 HELX_P HELX_P4 4 GLU A 43 ? PHE A 54 ? GLU A 43 PHE A 54 1 ? 12 HELX_P HELX_P5 5 GLN A 61 ? LYS A 73 ? GLN A 61 LYS A 73 1 ? 13 HELX_P HELX_P6 6 PHE A 87 ? ASN A 95 ? PHE A 87 ASN A 95 1 ? 9 HELX_P HELX_P7 7 PHE A 105 ? GLN A 118 ? PHE A 105 GLN A 118 5 ? 14 HELX_P HELX_P8 8 SER A 120 ? LEU A 125 ? SER A 120 LEU A 125 1 ? 6 HELX_P HELX_P9 9 ASP A 128 ? MET A 134 ? ASP A 128 MET A 134 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2DLV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DLV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 HIS 103 103 103 HIS HIS A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 MET 116 116 116 MET MET A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 TYR 130 130 130 TYR TYR A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 PRO 137 137 137 PRO PRO A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 GLY 140 140 140 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-04-17 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX Determination method: Author determined ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 43 ? ? -39.98 -38.97 2 1 ALA A 50 ? ? -36.00 -30.51 3 1 GLU A 72 ? ? -68.14 0.67 4 1 LYS A 73 ? ? -97.06 -68.62 5 1 PHE A 74 ? ? -98.03 -62.30 6 1 SER A 104 ? ? -93.59 -63.82 7 1 ASP A 119 ? ? -98.02 -66.05 8 1 PRO A 137 ? ? -69.74 7.25 9 2 LYS A 56 ? ? -38.87 -37.13 10 2 LYS A 73 ? ? -96.41 -68.46 11 2 PHE A 74 ? ? -98.08 -62.98 12 2 ILE A 75 ? ? -32.03 -72.99 13 2 GLU A 117 ? ? -39.95 -27.85 14 2 ASP A 119 ? ? -98.00 -63.38 15 2 LEU A 133 ? ? -39.65 -37.70 16 3 GLU A 43 ? ? -33.92 -34.98 17 3 LYS A 56 ? ? -38.15 -34.62 18 4 GLU A 43 ? ? -37.12 -26.63 19 4 LYS A 56 ? ? -37.27 -39.40 20 4 SER A 104 ? ? -86.62 -70.59 21 4 GLU A 117 ? ? -38.98 -29.63 22 4 GLN A 118 ? ? -53.22 -70.35 23 4 PRO A 137 ? ? -69.73 11.54 24 5 GLU A 43 ? ? -34.47 -32.30 25 5 LYS A 56 ? ? -37.98 -37.26 26 5 PHE A 74 ? ? -98.02 -62.11 27 5 SER A 104 ? ? -79.24 -70.65 28 5 ASP A 119 ? ? -98.07 -70.64 29 6 GLU A 43 ? ? -33.41 -33.21 30 6 GLN A 61 ? ? -38.41 -70.33 31 6 LYS A 73 ? ? -92.64 -62.77 32 6 PHE A 74 ? ? -104.04 -63.30 33 6 ILE A 75 ? ? -32.05 -71.12 34 6 GLU A 117 ? ? -37.95 -28.74 35 6 GLN A 118 ? ? -41.81 -70.22 36 7 GLU A 43 ? ? -39.58 -25.34 37 7 ILE A 75 ? ? -32.12 -73.85 38 7 GLN A 76 ? ? -52.17 170.72 39 7 GLU A 117 ? ? -36.87 -33.41 40 7 PRO A 137 ? ? -69.80 95.66 41 8 GLU A 43 ? ? -35.71 -29.91 42 8 LYS A 73 ? ? -95.04 -64.28 43 8 PHE A 74 ? ? -102.62 -63.22 44 8 ILE A 75 ? ? -32.12 -73.66 45 8 GLU A 117 ? ? -49.39 -17.67 46 8 GLN A 118 ? ? -64.49 -71.04 47 9 GLU A 43 ? ? -36.72 -26.51 48 9 LYS A 56 ? ? -39.58 -35.83 49 9 GLN A 61 ? ? -42.10 -70.01 50 9 ILE A 63 ? ? -37.10 -39.72 51 9 LYS A 73 ? ? -95.02 -63.87 52 9 PHE A 74 ? ? -103.96 -62.40 53 9 ILE A 75 ? ? -31.99 -70.26 54 9 GLU A 117 ? ? -39.15 -35.77 55 9 GLN A 118 ? ? -41.05 -71.83 56 9 ASP A 128 ? ? -33.29 -35.68 57 9 PRO A 137 ? ? -69.76 14.22 58 10 LYS A 56 ? ? -39.02 -31.54 59 10 ASP A 119 ? ? -98.03 -63.75 60 11 GLU A 43 ? ? -33.52 -34.07 61 11 PHE A 74 ? ? -98.50 -62.87 62 11 PRO A 137 ? ? -69.71 93.79 63 12 LYS A 56 ? ? -34.57 -36.70 64 12 GLN A 118 ? ? -58.40 -74.53 65 13 SER A 6 ? ? -53.84 101.99 66 13 GLU A 43 ? ? -39.41 -37.50 67 13 LYS A 56 ? ? -37.83 -32.19 68 13 PHE A 74 ? ? -98.09 -62.74 69 13 GLU A 117 ? ? -37.00 -31.51 70 14 GLU A 43 ? ? -37.76 -39.74 71 14 GLN A 61 ? ? -47.28 -70.93 72 14 GLN A 76 ? ? -57.39 173.63 73 14 SER A 104 ? ? -95.20 -68.72 74 14 ASP A 119 ? ? -98.02 -64.13 75 14 LEU A 131 ? ? -39.30 -38.77 76 14 PRO A 137 ? ? -69.72 90.63 77 15 ALA A 50 ? ? -37.12 -28.73 78 15 LYS A 56 ? ? -34.96 -36.15 79 15 GLN A 118 ? ? -69.46 -71.97 80 15 LEU A 133 ? ? -39.89 -33.13 81 15 PRO A 137 ? ? -69.74 8.63 82 16 LYS A 73 ? ? -96.56 -68.85 83 16 PHE A 74 ? ? -97.99 -63.45 84 16 ILE A 75 ? ? -32.15 -73.78 85 16 GLU A 117 ? ? -39.41 -33.23 86 16 PRO A 137 ? ? -69.73 87.72 87 17 GLU A 43 ? ? -33.88 -33.21 88 17 GLN A 61 ? ? -41.02 -70.77 89 18 GLU A 43 ? ? -36.50 -34.59 90 18 LYS A 73 ? ? -93.11 -65.37 91 18 PHE A 74 ? ? -97.92 -64.06 92 18 GLU A 117 ? ? -48.41 -17.20 93 18 PRO A 137 ? ? -69.73 90.06 94 19 GLU A 43 ? ? -34.21 -34.01 95 19 LYS A 56 ? ? -33.20 -34.24 96 19 LYS A 73 ? ? -91.72 -68.89 97 19 PHE A 74 ? ? -98.34 -61.09 98 19 SER A 104 ? ? -79.02 -70.19 99 19 GLN A 118 ? ? -57.89 -74.70 100 20 GLU A 43 ? ? -35.65 -32.78 101 20 LYS A 56 ? ? -37.58 -33.82 102 20 PHE A 74 ? ? -108.77 -62.33 103 20 ILE A 75 ? ? -32.47 -73.06 104 20 LEU A 115 ? ? -34.09 -38.41 105 20 GLN A 118 ? ? -59.10 -70.67 #