data_2DMA # _entry.id 2DMA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DMA pdb_00002dma 10.2210/pdb2dma/pdb RCSB RCSB025581 ? ? WWPDB D_1000025581 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2DM9 'the same protein(form I)' unspecified TargetDB pho001001978.2 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DMA _pdbx_database_status.recvd_initial_deposition_date 2006-04-20 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lokanath, N.K.' 1 'Kunishima, N.' 2 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystal Structure of PH1978 from Pyrococcus horikoshii OT3 (form II)' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'Dimeric Core Structure of Modular Stator Subunit E of Archaeal H(+)-ATPase' J.Mol.Biol. 366 933 944 2007 JMOBAK UK 0022-2836 0070 ? 17189637 10.1016/j.jmb.2006.11.088 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lokanath, N.K.' 1 ? primary 'Kunishima, N.' 2 ? 1 'Lokanath, N.K.' 3 ? 1 'Matsuura, Y.' 4 ? 1 'Kuroishi, C.' 5 ? 1 'Takahashi, N.' 6 ? 1 'Kunishima, N.' 7 ? # _cell.entry_id 2DMA _cell.length_a 71.235 _cell.length_b 78.067 _cell.length_c 52.829 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2DMA _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'V-type ATP synthase subunit E' 23159.746 1 3.6.3.14 ? ? ? 2 water nat water 18.015 77 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'A-ATPase, V-type ATPase subunit E' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)NGAELIIQEINKEAERKIEYILNEARQQAEKIKEEARRNAEAKAEWIIRRAKTQAELEKQRIIANARLEVRRKRL AIQEEIISSVLEEVKRRLET(MSE)SEDEYFESVKALLKEAIKELNEKKVRV(MSE)SNEKTLGLIASRIEEIKSELGDV SIELGETVDT(MSE)GGVIVETEDGRIRIDNTFEAR(MSE)ERFEGEIRSTIAKVLFG ; _entity_poly.pdbx_seq_one_letter_code_can ;MNGAELIIQEINKEAERKIEYILNEARQQAEKIKEEARRNAEAKAEWIIRRAKTQAELEKQRIIANARLEVRRKRLAIQE EIISSVLEEVKRRLETMSEDEYFESVKALLKEAIKELNEKKVRVMSNEKTLGLIASRIEEIKSELGDVSIELGETVDTMG GVIVETEDGRIRIDNTFEARMERFEGEIRSTIAKVLFG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier pho001001978.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ASN n 1 3 GLY n 1 4 ALA n 1 5 GLU n 1 6 LEU n 1 7 ILE n 1 8 ILE n 1 9 GLN n 1 10 GLU n 1 11 ILE n 1 12 ASN n 1 13 LYS n 1 14 GLU n 1 15 ALA n 1 16 GLU n 1 17 ARG n 1 18 LYS n 1 19 ILE n 1 20 GLU n 1 21 TYR n 1 22 ILE n 1 23 LEU n 1 24 ASN n 1 25 GLU n 1 26 ALA n 1 27 ARG n 1 28 GLN n 1 29 GLN n 1 30 ALA n 1 31 GLU n 1 32 LYS n 1 33 ILE n 1 34 LYS n 1 35 GLU n 1 36 GLU n 1 37 ALA n 1 38 ARG n 1 39 ARG n 1 40 ASN n 1 41 ALA n 1 42 GLU n 1 43 ALA n 1 44 LYS n 1 45 ALA n 1 46 GLU n 1 47 TRP n 1 48 ILE n 1 49 ILE n 1 50 ARG n 1 51 ARG n 1 52 ALA n 1 53 LYS n 1 54 THR n 1 55 GLN n 1 56 ALA n 1 57 GLU n 1 58 LEU n 1 59 GLU n 1 60 LYS n 1 61 GLN n 1 62 ARG n 1 63 ILE n 1 64 ILE n 1 65 ALA n 1 66 ASN n 1 67 ALA n 1 68 ARG n 1 69 LEU n 1 70 GLU n 1 71 VAL n 1 72 ARG n 1 73 ARG n 1 74 LYS n 1 75 ARG n 1 76 LEU n 1 77 ALA n 1 78 ILE n 1 79 GLN n 1 80 GLU n 1 81 GLU n 1 82 ILE n 1 83 ILE n 1 84 SER n 1 85 SER n 1 86 VAL n 1 87 LEU n 1 88 GLU n 1 89 GLU n 1 90 VAL n 1 91 LYS n 1 92 ARG n 1 93 ARG n 1 94 LEU n 1 95 GLU n 1 96 THR n 1 97 MSE n 1 98 SER n 1 99 GLU n 1 100 ASP n 1 101 GLU n 1 102 TYR n 1 103 PHE n 1 104 GLU n 1 105 SER n 1 106 VAL n 1 107 LYS n 1 108 ALA n 1 109 LEU n 1 110 LEU n 1 111 LYS n 1 112 GLU n 1 113 ALA n 1 114 ILE n 1 115 LYS n 1 116 GLU n 1 117 LEU n 1 118 ASN n 1 119 GLU n 1 120 LYS n 1 121 LYS n 1 122 VAL n 1 123 ARG n 1 124 VAL n 1 125 MSE n 1 126 SER n 1 127 ASN n 1 128 GLU n 1 129 LYS n 1 130 THR n 1 131 LEU n 1 132 GLY n 1 133 LEU n 1 134 ILE n 1 135 ALA n 1 136 SER n 1 137 ARG n 1 138 ILE n 1 139 GLU n 1 140 GLU n 1 141 ILE n 1 142 LYS n 1 143 SER n 1 144 GLU n 1 145 LEU n 1 146 GLY n 1 147 ASP n 1 148 VAL n 1 149 SER n 1 150 ILE n 1 151 GLU n 1 152 LEU n 1 153 GLY n 1 154 GLU n 1 155 THR n 1 156 VAL n 1 157 ASP n 1 158 THR n 1 159 MSE n 1 160 GLY n 1 161 GLY n 1 162 VAL n 1 163 ILE n 1 164 VAL n 1 165 GLU n 1 166 THR n 1 167 GLU n 1 168 ASP n 1 169 GLY n 1 170 ARG n 1 171 ILE n 1 172 ARG n 1 173 ILE n 1 174 ASP n 1 175 ASN n 1 176 THR n 1 177 PHE n 1 178 GLU n 1 179 ALA n 1 180 ARG n 1 181 MSE n 1 182 GLU n 1 183 ARG n 1 184 PHE n 1 185 GLU n 1 186 GLY n 1 187 GLU n 1 188 ILE n 1 189 ARG n 1 190 SER n 1 191 THR n 1 192 ILE n 1 193 ALA n 1 194 LYS n 1 195 VAL n 1 196 LEU n 1 197 PHE n 1 198 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pyrococcus _entity_src_gen.pdbx_gene_src_gene atpE _entity_src_gen.gene_src_species 'Pyrococcus horikoshii' _entity_src_gen.gene_src_strain OT3 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus horikoshii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 70601 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 Codon Plus (DE3)-RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VATE_PYRHO _struct_ref.pdbx_db_accession O57724 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNGAELIIQEINKEAERKIEYILNEARQQAEKIKEEARRNAEAKAEWIIRRAKTQAELEKQRIIANARLEVRRKRLAIQE EIISSVLEEVKRRLETMSEDEYFESVKALLKEAIKELNEKKVRVMSNEKTLGLIASRIEEIKSELGDVSIELGETVDTMG GVIVETEDGRIRIDNTFEARMERFEGEIRSTIAKVLFG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DMA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 198 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O57724 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 198 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 198 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DMA MSE A 1 ? UNP O57724 MET 1 'modified residue' 1 1 1 2DMA MSE A 97 ? UNP O57724 MET 97 'modified residue' 97 2 1 2DMA MSE A 125 ? UNP O57724 MET 125 'modified residue' 125 3 1 2DMA MSE A 159 ? UNP O57724 MET 159 'modified residue' 159 4 1 2DMA MSE A 181 ? UNP O57724 MET 181 'modified residue' 181 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2DMA _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.60 _exptl_crystal.density_percent_sol 28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method MICROBATCH _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 9.0 _exptl_crystal_grow.pdbx_details 'PEG-MME 550, Bicine-HCl, NaCl, pH 9.0, microbatch, temperature 295K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS V' _diffrn_detector.pdbx_collection_date 2004-10-14 _diffrn_detector.details 'RH coated bent-cylindrical mirror' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI111 double crystal monochromator' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL26B1' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL26B1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0 # _reflns.entry_id 2DMA _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 40.0 _reflns.d_resolution_high 2.05 _reflns.number_obs 9552 _reflns.number_all 9568 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.079 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.1 _reflns.B_iso_Wilson_estimate 14.1 _reflns.pdbx_redundancy 5.4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.05 _reflns_shell.d_res_low 2.12 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2DMA _refine.ls_number_reflns_obs 9552 _refine.ls_number_reflns_all 9568 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 2110625.22 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 39.03 _refine.ls_d_res_high 2.05 _refine.ls_percent_reflns_obs 99.9 _refine.ls_R_factor_obs 0.224 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.224 _refine.ls_R_factor_R_free 0.261 _refine.ls_R_factor_R_free_error 0.012 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.3 _refine.ls_number_reflns_R_free 506 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 33.2 _refine.aniso_B[1][1] 21.17 _refine.aniso_B[2][2] -9.68 _refine.aniso_B[3][3] -11.49 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.371595 _refine.solvent_model_param_bsol 47.3537 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 2DM9 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2DMA _refine_analyze.Luzzati_coordinate_error_obs 0.26 _refine_analyze.Luzzati_sigma_a_obs 0.27 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.32 _refine_analyze.Luzzati_sigma_a_free 0.29 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 937 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 77 _refine_hist.number_atoms_total 1014 _refine_hist.d_res_high 2.05 _refine_hist.d_res_low 39.03 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 20.5 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.76 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.43 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.21 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 3.12 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 4.46 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.05 _refine_ls_shell.d_res_low 2.18 _refine_ls_shell.number_reflns_R_work 1485 _refine_ls_shell.R_factor_R_work 0.29 _refine_ls_shell.percent_reflns_obs 100.0 _refine_ls_shell.R_factor_R_free 0.275 _refine_ls_shell.R_factor_R_free_error 0.032 _refine_ls_shell.percent_reflns_R_free 4.7 _refine_ls_shell.number_reflns_R_free 74 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 water_rep.param water.top 'X-RAY DIFFRACTION' 3 ion.param ion.top 'X-RAY DIFFRACTION' # _struct.entry_id 2DMA _struct.title 'Crystal Structure of PH1978 from Pyrococcus horikoshii OT3 (form II)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DMA _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;A-ATpase, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 81 ? MSE A 97 ? GLU A 81 MSE A 97 1 ? 17 HELX_P HELX_P2 2 SER A 98 ? ASN A 118 ? SER A 98 ASN A 118 1 ? 21 HELX_P HELX_P3 3 ASN A 127 ? ARG A 137 ? ASN A 127 ARG A 137 1 ? 11 HELX_P HELX_P4 4 ARG A 137 ? GLY A 146 ? ARG A 137 GLY A 146 1 ? 10 HELX_P HELX_P5 5 PHE A 177 ? PHE A 184 ? PHE A 177 PHE A 184 1 ? 8 HELX_P HELX_P6 6 PHE A 184 ? GLY A 198 ? PHE A 184 GLY A 198 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A THR 96 C ? ? ? 1_555 A MSE 97 N ? ? A THR 96 A MSE 97 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A MSE 97 C ? ? ? 1_555 A SER 98 N ? ? A MSE 97 A SER 98 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale3 covale both ? A VAL 124 C ? ? ? 1_555 A MSE 125 N ? ? A VAL 124 A MSE 125 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale4 covale both ? A MSE 125 C ? ? ? 1_555 A SER 126 N ? ? A MSE 125 A SER 126 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale5 covale both ? A THR 158 C ? ? ? 1_555 A MSE 159 N ? ? A THR 158 A MSE 159 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale6 covale both ? A MSE 159 C ? ? ? 1_555 A GLY 160 N ? ? A MSE 159 A GLY 160 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale7 covale both ? A ARG 180 C ? ? ? 1_555 A MSE 181 N ? ? A ARG 180 A MSE 181 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale8 covale both ? A MSE 181 C ? ? ? 1_555 A GLU 182 N ? ? A MSE 181 A GLU 182 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 149 ? LEU A 152 ? SER A 149 LEU A 152 A 2 LYS A 121 ? MSE A 125 ? LYS A 121 MSE A 125 A 3 GLY A 161 ? THR A 166 ? GLY A 161 THR A 166 A 4 ARG A 172 ? THR A 176 ? ARG A 172 THR A 176 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O SER A 149 ? O SER A 149 N VAL A 122 ? N VAL A 122 A 2 3 N ARG A 123 ? N ARG A 123 O GLU A 165 ? O GLU A 165 A 3 4 N VAL A 164 ? N VAL A 164 O ILE A 173 ? O ILE A 173 # _database_PDB_matrix.entry_id 2DMA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DMA _atom_sites.fract_transf_matrix[1][1] 0.014038 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012810 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018929 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 ALA 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 ILE 7 7 ? ? ? A . n A 1 8 ILE 8 8 ? ? ? A . n A 1 9 GLN 9 9 ? ? ? A . n A 1 10 GLU 10 10 ? ? ? A . n A 1 11 ILE 11 11 ? ? ? A . n A 1 12 ASN 12 12 ? ? ? A . n A 1 13 LYS 13 13 ? ? ? A . n A 1 14 GLU 14 14 ? ? ? A . n A 1 15 ALA 15 15 ? ? ? A . n A 1 16 GLU 16 16 ? ? ? A . n A 1 17 ARG 17 17 ? ? ? A . n A 1 18 LYS 18 18 ? ? ? A . n A 1 19 ILE 19 19 ? ? ? A . n A 1 20 GLU 20 20 ? ? ? A . n A 1 21 TYR 21 21 ? ? ? A . n A 1 22 ILE 22 22 ? ? ? A . n A 1 23 LEU 23 23 ? ? ? A . n A 1 24 ASN 24 24 ? ? ? A . n A 1 25 GLU 25 25 ? ? ? A . n A 1 26 ALA 26 26 ? ? ? A . n A 1 27 ARG 27 27 ? ? ? A . n A 1 28 GLN 28 28 ? ? ? A . n A 1 29 GLN 29 29 ? ? ? A . n A 1 30 ALA 30 30 ? ? ? A . n A 1 31 GLU 31 31 ? ? ? A . n A 1 32 LYS 32 32 ? ? ? A . n A 1 33 ILE 33 33 ? ? ? A . n A 1 34 LYS 34 34 ? ? ? A . n A 1 35 GLU 35 35 ? ? ? A . n A 1 36 GLU 36 36 ? ? ? A . n A 1 37 ALA 37 37 ? ? ? A . n A 1 38 ARG 38 38 ? ? ? A . n A 1 39 ARG 39 39 ? ? ? A . n A 1 40 ASN 40 40 ? ? ? A . n A 1 41 ALA 41 41 ? ? ? A . n A 1 42 GLU 42 42 ? ? ? A . n A 1 43 ALA 43 43 ? ? ? A . n A 1 44 LYS 44 44 ? ? ? A . n A 1 45 ALA 45 45 ? ? ? A . n A 1 46 GLU 46 46 ? ? ? A . n A 1 47 TRP 47 47 ? ? ? A . n A 1 48 ILE 48 48 ? ? ? A . n A 1 49 ILE 49 49 ? ? ? A . n A 1 50 ARG 50 50 ? ? ? A . n A 1 51 ARG 51 51 ? ? ? A . n A 1 52 ALA 52 52 ? ? ? A . n A 1 53 LYS 53 53 ? ? ? A . n A 1 54 THR 54 54 ? ? ? A . n A 1 55 GLN 55 55 ? ? ? A . n A 1 56 ALA 56 56 ? ? ? A . n A 1 57 GLU 57 57 ? ? ? A . n A 1 58 LEU 58 58 ? ? ? A . n A 1 59 GLU 59 59 ? ? ? A . n A 1 60 LYS 60 60 ? ? ? A . n A 1 61 GLN 61 61 ? ? ? A . n A 1 62 ARG 62 62 ? ? ? A . n A 1 63 ILE 63 63 ? ? ? A . n A 1 64 ILE 64 64 ? ? ? A . n A 1 65 ALA 65 65 ? ? ? A . n A 1 66 ASN 66 66 ? ? ? A . n A 1 67 ALA 67 67 ? ? ? A . n A 1 68 ARG 68 68 ? ? ? A . n A 1 69 LEU 69 69 ? ? ? A . n A 1 70 GLU 70 70 ? ? ? A . n A 1 71 VAL 71 71 ? ? ? A . n A 1 72 ARG 72 72 ? ? ? A . n A 1 73 ARG 73 73 ? ? ? A . n A 1 74 LYS 74 74 ? ? ? A . n A 1 75 ARG 75 75 ? ? ? A . n A 1 76 LEU 76 76 ? ? ? A . n A 1 77 ALA 77 77 ? ? ? A . n A 1 78 ILE 78 78 ? ? ? A . n A 1 79 GLN 79 79 ? ? ? A . n A 1 80 GLU 80 80 ? ? ? A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 MSE 97 97 97 MSE MSE A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 MSE 125 125 125 MSE MSE A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 MSE 159 159 159 MSE MSE A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 GLU 165 165 165 GLU GLU A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 PHE 177 177 177 PHE PHE A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 MSE 181 181 181 MSE MSE A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 THR 191 191 191 THR THR A . n A 1 192 ILE 192 192 192 ILE ILE A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 LYS 194 194 194 LYS LYS A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 PHE 197 197 197 PHE PHE A . n A 1 198 GLY 198 198 198 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 199 1 HOH HOH A . B 2 HOH 2 200 2 HOH HOH A . B 2 HOH 3 201 3 HOH HOH A . B 2 HOH 4 202 4 HOH HOH A . B 2 HOH 5 203 5 HOH HOH A . B 2 HOH 6 204 6 HOH HOH A . B 2 HOH 7 205 7 HOH HOH A . B 2 HOH 8 206 8 HOH HOH A . B 2 HOH 9 207 9 HOH HOH A . B 2 HOH 10 208 10 HOH HOH A . B 2 HOH 11 209 11 HOH HOH A . B 2 HOH 12 210 12 HOH HOH A . B 2 HOH 13 211 13 HOH HOH A . B 2 HOH 14 212 14 HOH HOH A . B 2 HOH 15 213 15 HOH HOH A . B 2 HOH 16 214 16 HOH HOH A . B 2 HOH 17 215 17 HOH HOH A . B 2 HOH 18 216 18 HOH HOH A . B 2 HOH 19 217 19 HOH HOH A . B 2 HOH 20 218 20 HOH HOH A . B 2 HOH 21 219 21 HOH HOH A . B 2 HOH 22 220 22 HOH HOH A . B 2 HOH 23 221 23 HOH HOH A . B 2 HOH 24 222 24 HOH HOH A . B 2 HOH 25 223 25 HOH HOH A . B 2 HOH 26 224 26 HOH HOH A . B 2 HOH 27 225 27 HOH HOH A . B 2 HOH 28 226 28 HOH HOH A . B 2 HOH 29 227 29 HOH HOH A . B 2 HOH 30 228 30 HOH HOH A . B 2 HOH 31 229 31 HOH HOH A . B 2 HOH 32 230 32 HOH HOH A . B 2 HOH 33 231 33 HOH HOH A . B 2 HOH 34 232 34 HOH HOH A . B 2 HOH 35 233 35 HOH HOH A . B 2 HOH 36 234 36 HOH HOH A . B 2 HOH 37 235 37 HOH HOH A . B 2 HOH 38 236 38 HOH HOH A . B 2 HOH 39 237 39 HOH HOH A . B 2 HOH 40 238 40 HOH HOH A . B 2 HOH 41 239 41 HOH HOH A . B 2 HOH 42 240 42 HOH HOH A . B 2 HOH 43 241 43 HOH HOH A . B 2 HOH 44 242 44 HOH HOH A . B 2 HOH 45 243 46 HOH HOH A . B 2 HOH 46 244 47 HOH HOH A . B 2 HOH 47 245 48 HOH HOH A . B 2 HOH 48 246 49 HOH HOH A . B 2 HOH 49 247 50 HOH HOH A . B 2 HOH 50 248 51 HOH HOH A . B 2 HOH 51 249 52 HOH HOH A . B 2 HOH 52 250 53 HOH HOH A . B 2 HOH 53 251 54 HOH HOH A . B 2 HOH 54 252 55 HOH HOH A . B 2 HOH 55 253 56 HOH HOH A . B 2 HOH 56 254 57 HOH HOH A . B 2 HOH 57 255 59 HOH HOH A . B 2 HOH 58 256 60 HOH HOH A . B 2 HOH 59 257 61 HOH HOH A . B 2 HOH 60 258 62 HOH HOH A . B 2 HOH 61 259 63 HOH HOH A . B 2 HOH 62 260 64 HOH HOH A . B 2 HOH 63 261 65 HOH HOH A . B 2 HOH 64 262 66 HOH HOH A . B 2 HOH 65 263 67 HOH HOH A . B 2 HOH 66 264 68 HOH HOH A . B 2 HOH 67 265 69 HOH HOH A . B 2 HOH 68 266 70 HOH HOH A . B 2 HOH 69 267 72 HOH HOH A . B 2 HOH 70 268 73 HOH HOH A . B 2 HOH 71 269 74 HOH HOH A . B 2 HOH 72 270 75 HOH HOH A . B 2 HOH 73 271 76 HOH HOH A . B 2 HOH 74 272 77 HOH HOH A . B 2 HOH 75 273 78 HOH HOH A . B 2 HOH 76 274 79 HOH HOH A . B 2 HOH 77 275 80 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 97 A MSE 97 ? MET SELENOMETHIONINE 2 A MSE 125 A MSE 125 ? MET SELENOMETHIONINE 3 A MSE 159 A MSE 159 ? MET SELENOMETHIONINE 4 A MSE 181 A MSE 181 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2710 ? 1 MORE -20 ? 1 'SSA (A^2)' 12010 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_556 x,-y,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 52.8290000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 245 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-01-16 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-10-25 5 'Structure model' 1 4 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Source and taxonomy' 4 3 'Structure model' 'Version format compliance' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Refinement description' 9 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_initial_refinement_model 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 5 'Structure model' '_chem_comp_atom.atom_id' 6 5 'Structure model' '_chem_comp_bond.atom_id_2' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 CNS phasing . ? 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 126 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -167.67 _pdbx_validate_torsion.psi -168.26 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A ALA 4 ? A ALA 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A ILE 7 ? A ILE 7 8 1 Y 1 A ILE 8 ? A ILE 8 9 1 Y 1 A GLN 9 ? A GLN 9 10 1 Y 1 A GLU 10 ? A GLU 10 11 1 Y 1 A ILE 11 ? A ILE 11 12 1 Y 1 A ASN 12 ? A ASN 12 13 1 Y 1 A LYS 13 ? A LYS 13 14 1 Y 1 A GLU 14 ? A GLU 14 15 1 Y 1 A ALA 15 ? A ALA 15 16 1 Y 1 A GLU 16 ? A GLU 16 17 1 Y 1 A ARG 17 ? A ARG 17 18 1 Y 1 A LYS 18 ? A LYS 18 19 1 Y 1 A ILE 19 ? A ILE 19 20 1 Y 1 A GLU 20 ? A GLU 20 21 1 Y 1 A TYR 21 ? A TYR 21 22 1 Y 1 A ILE 22 ? A ILE 22 23 1 Y 1 A LEU 23 ? A LEU 23 24 1 Y 1 A ASN 24 ? A ASN 24 25 1 Y 1 A GLU 25 ? A GLU 25 26 1 Y 1 A ALA 26 ? A ALA 26 27 1 Y 1 A ARG 27 ? A ARG 27 28 1 Y 1 A GLN 28 ? A GLN 28 29 1 Y 1 A GLN 29 ? A GLN 29 30 1 Y 1 A ALA 30 ? A ALA 30 31 1 Y 1 A GLU 31 ? A GLU 31 32 1 Y 1 A LYS 32 ? A LYS 32 33 1 Y 1 A ILE 33 ? A ILE 33 34 1 Y 1 A LYS 34 ? A LYS 34 35 1 Y 1 A GLU 35 ? A GLU 35 36 1 Y 1 A GLU 36 ? A GLU 36 37 1 Y 1 A ALA 37 ? A ALA 37 38 1 Y 1 A ARG 38 ? A ARG 38 39 1 Y 1 A ARG 39 ? A ARG 39 40 1 Y 1 A ASN 40 ? A ASN 40 41 1 Y 1 A ALA 41 ? A ALA 41 42 1 Y 1 A GLU 42 ? A GLU 42 43 1 Y 1 A ALA 43 ? A ALA 43 44 1 Y 1 A LYS 44 ? A LYS 44 45 1 Y 1 A ALA 45 ? A ALA 45 46 1 Y 1 A GLU 46 ? A GLU 46 47 1 Y 1 A TRP 47 ? A TRP 47 48 1 Y 1 A ILE 48 ? A ILE 48 49 1 Y 1 A ILE 49 ? A ILE 49 50 1 Y 1 A ARG 50 ? A ARG 50 51 1 Y 1 A ARG 51 ? A ARG 51 52 1 Y 1 A ALA 52 ? A ALA 52 53 1 Y 1 A LYS 53 ? A LYS 53 54 1 Y 1 A THR 54 ? A THR 54 55 1 Y 1 A GLN 55 ? A GLN 55 56 1 Y 1 A ALA 56 ? A ALA 56 57 1 Y 1 A GLU 57 ? A GLU 57 58 1 Y 1 A LEU 58 ? A LEU 58 59 1 Y 1 A GLU 59 ? A GLU 59 60 1 Y 1 A LYS 60 ? A LYS 60 61 1 Y 1 A GLN 61 ? A GLN 61 62 1 Y 1 A ARG 62 ? A ARG 62 63 1 Y 1 A ILE 63 ? A ILE 63 64 1 Y 1 A ILE 64 ? A ILE 64 65 1 Y 1 A ALA 65 ? A ALA 65 66 1 Y 1 A ASN 66 ? A ASN 66 67 1 Y 1 A ALA 67 ? A ALA 67 68 1 Y 1 A ARG 68 ? A ARG 68 69 1 Y 1 A LEU 69 ? A LEU 69 70 1 Y 1 A GLU 70 ? A GLU 70 71 1 Y 1 A VAL 71 ? A VAL 71 72 1 Y 1 A ARG 72 ? A ARG 72 73 1 Y 1 A ARG 73 ? A ARG 73 74 1 Y 1 A LYS 74 ? A LYS 74 75 1 Y 1 A ARG 75 ? A ARG 75 76 1 Y 1 A LEU 76 ? A LEU 76 77 1 Y 1 A ALA 77 ? A ALA 77 78 1 Y 1 A ILE 78 ? A ILE 78 79 1 Y 1 A GLN 79 ? A GLN 79 80 1 Y 1 A GLU 80 ? A GLU 80 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HOH O O N N 123 HOH H1 H N N 124 HOH H2 H N N 125 ILE N N N N 126 ILE CA C N S 127 ILE C C N N 128 ILE O O N N 129 ILE CB C N S 130 ILE CG1 C N N 131 ILE CG2 C N N 132 ILE CD1 C N N 133 ILE OXT O N N 134 ILE H H N N 135 ILE H2 H N N 136 ILE HA H N N 137 ILE HB H N N 138 ILE HG12 H N N 139 ILE HG13 H N N 140 ILE HG21 H N N 141 ILE HG22 H N N 142 ILE HG23 H N N 143 ILE HD11 H N N 144 ILE HD12 H N N 145 ILE HD13 H N N 146 ILE HXT H N N 147 LEU N N N N 148 LEU CA C N S 149 LEU C C N N 150 LEU O O N N 151 LEU CB C N N 152 LEU CG C N N 153 LEU CD1 C N N 154 LEU CD2 C N N 155 LEU OXT O N N 156 LEU H H N N 157 LEU H2 H N N 158 LEU HA H N N 159 LEU HB2 H N N 160 LEU HB3 H N N 161 LEU HG H N N 162 LEU HD11 H N N 163 LEU HD12 H N N 164 LEU HD13 H N N 165 LEU HD21 H N N 166 LEU HD22 H N N 167 LEU HD23 H N N 168 LEU HXT H N N 169 LYS N N N N 170 LYS CA C N S 171 LYS C C N N 172 LYS O O N N 173 LYS CB C N N 174 LYS CG C N N 175 LYS CD C N N 176 LYS CE C N N 177 LYS NZ N N N 178 LYS OXT O N N 179 LYS H H N N 180 LYS H2 H N N 181 LYS HA H N N 182 LYS HB2 H N N 183 LYS HB3 H N N 184 LYS HG2 H N N 185 LYS HG3 H N N 186 LYS HD2 H N N 187 LYS HD3 H N N 188 LYS HE2 H N N 189 LYS HE3 H N N 190 LYS HZ1 H N N 191 LYS HZ2 H N N 192 LYS HZ3 H N N 193 LYS HXT H N N 194 MET N N N N 195 MET CA C N S 196 MET C C N N 197 MET O O N N 198 MET CB C N N 199 MET CG C N N 200 MET SD S N N 201 MET CE C N N 202 MET OXT O N N 203 MET H H N N 204 MET H2 H N N 205 MET HA H N N 206 MET HB2 H N N 207 MET HB3 H N N 208 MET HG2 H N N 209 MET HG3 H N N 210 MET HE1 H N N 211 MET HE2 H N N 212 MET HE3 H N N 213 MET HXT H N N 214 MSE N N N N 215 MSE CA C N S 216 MSE C C N N 217 MSE O O N N 218 MSE OXT O N N 219 MSE CB C N N 220 MSE CG C N N 221 MSE SE SE N N 222 MSE CE C N N 223 MSE H H N N 224 MSE H2 H N N 225 MSE HA H N N 226 MSE HXT H N N 227 MSE HB2 H N N 228 MSE HB3 H N N 229 MSE HG2 H N N 230 MSE HG3 H N N 231 MSE HE1 H N N 232 MSE HE2 H N N 233 MSE HE3 H N N 234 PHE N N N N 235 PHE CA C N S 236 PHE C C N N 237 PHE O O N N 238 PHE CB C N N 239 PHE CG C Y N 240 PHE CD1 C Y N 241 PHE CD2 C Y N 242 PHE CE1 C Y N 243 PHE CE2 C Y N 244 PHE CZ C Y N 245 PHE OXT O N N 246 PHE H H N N 247 PHE H2 H N N 248 PHE HA H N N 249 PHE HB2 H N N 250 PHE HB3 H N N 251 PHE HD1 H N N 252 PHE HD2 H N N 253 PHE HE1 H N N 254 PHE HE2 H N N 255 PHE HZ H N N 256 PHE HXT H N N 257 SER N N N N 258 SER CA C N S 259 SER C C N N 260 SER O O N N 261 SER CB C N N 262 SER OG O N N 263 SER OXT O N N 264 SER H H N N 265 SER H2 H N N 266 SER HA H N N 267 SER HB2 H N N 268 SER HB3 H N N 269 SER HG H N N 270 SER HXT H N N 271 THR N N N N 272 THR CA C N S 273 THR C C N N 274 THR O O N N 275 THR CB C N R 276 THR OG1 O N N 277 THR CG2 C N N 278 THR OXT O N N 279 THR H H N N 280 THR H2 H N N 281 THR HA H N N 282 THR HB H N N 283 THR HG1 H N N 284 THR HG21 H N N 285 THR HG22 H N N 286 THR HG23 H N N 287 THR HXT H N N 288 TRP N N N N 289 TRP CA C N S 290 TRP C C N N 291 TRP O O N N 292 TRP CB C N N 293 TRP CG C Y N 294 TRP CD1 C Y N 295 TRP CD2 C Y N 296 TRP NE1 N Y N 297 TRP CE2 C Y N 298 TRP CE3 C Y N 299 TRP CZ2 C Y N 300 TRP CZ3 C Y N 301 TRP CH2 C Y N 302 TRP OXT O N N 303 TRP H H N N 304 TRP H2 H N N 305 TRP HA H N N 306 TRP HB2 H N N 307 TRP HB3 H N N 308 TRP HD1 H N N 309 TRP HE1 H N N 310 TRP HE3 H N N 311 TRP HZ2 H N N 312 TRP HZ3 H N N 313 TRP HH2 H N N 314 TRP HXT H N N 315 TYR N N N N 316 TYR CA C N S 317 TYR C C N N 318 TYR O O N N 319 TYR CB C N N 320 TYR CG C Y N 321 TYR CD1 C Y N 322 TYR CD2 C Y N 323 TYR CE1 C Y N 324 TYR CE2 C Y N 325 TYR CZ C Y N 326 TYR OH O N N 327 TYR OXT O N N 328 TYR H H N N 329 TYR H2 H N N 330 TYR HA H N N 331 TYR HB2 H N N 332 TYR HB3 H N N 333 TYR HD1 H N N 334 TYR HD2 H N N 335 TYR HE1 H N N 336 TYR HE2 H N N 337 TYR HH H N N 338 TYR HXT H N N 339 VAL N N N N 340 VAL CA C N S 341 VAL C C N N 342 VAL O O N N 343 VAL CB C N N 344 VAL CG1 C N N 345 VAL CG2 C N N 346 VAL OXT O N N 347 VAL H H N N 348 VAL H2 H N N 349 VAL HA H N N 350 VAL HB H N N 351 VAL HG11 H N N 352 VAL HG12 H N N 353 VAL HG13 H N N 354 VAL HG21 H N N 355 VAL HG22 H N N 356 VAL HG23 H N N 357 VAL HXT H N N 358 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 MSE N CA sing N N 203 MSE N H sing N N 204 MSE N H2 sing N N 205 MSE CA C sing N N 206 MSE CA CB sing N N 207 MSE CA HA sing N N 208 MSE C O doub N N 209 MSE C OXT sing N N 210 MSE OXT HXT sing N N 211 MSE CB CG sing N N 212 MSE CB HB2 sing N N 213 MSE CB HB3 sing N N 214 MSE CG SE sing N N 215 MSE CG HG2 sing N N 216 MSE CG HG3 sing N N 217 MSE SE CE sing N N 218 MSE CE HE1 sing N N 219 MSE CE HE2 sing N N 220 MSE CE HE3 sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 THR N CA sing N N 258 THR N H sing N N 259 THR N H2 sing N N 260 THR CA C sing N N 261 THR CA CB sing N N 262 THR CA HA sing N N 263 THR C O doub N N 264 THR C OXT sing N N 265 THR CB OG1 sing N N 266 THR CB CG2 sing N N 267 THR CB HB sing N N 268 THR OG1 HG1 sing N N 269 THR CG2 HG21 sing N N 270 THR CG2 HG22 sing N N 271 THR CG2 HG23 sing N N 272 THR OXT HXT sing N N 273 TRP N CA sing N N 274 TRP N H sing N N 275 TRP N H2 sing N N 276 TRP CA C sing N N 277 TRP CA CB sing N N 278 TRP CA HA sing N N 279 TRP C O doub N N 280 TRP C OXT sing N N 281 TRP CB CG sing N N 282 TRP CB HB2 sing N N 283 TRP CB HB3 sing N N 284 TRP CG CD1 doub Y N 285 TRP CG CD2 sing Y N 286 TRP CD1 NE1 sing Y N 287 TRP CD1 HD1 sing N N 288 TRP CD2 CE2 doub Y N 289 TRP CD2 CE3 sing Y N 290 TRP NE1 CE2 sing Y N 291 TRP NE1 HE1 sing N N 292 TRP CE2 CZ2 sing Y N 293 TRP CE3 CZ3 doub Y N 294 TRP CE3 HE3 sing N N 295 TRP CZ2 CH2 doub Y N 296 TRP CZ2 HZ2 sing N N 297 TRP CZ3 CH2 sing Y N 298 TRP CZ3 HZ3 sing N N 299 TRP CH2 HH2 sing N N 300 TRP OXT HXT sing N N 301 TYR N CA sing N N 302 TYR N H sing N N 303 TYR N H2 sing N N 304 TYR CA C sing N N 305 TYR CA CB sing N N 306 TYR CA HA sing N N 307 TYR C O doub N N 308 TYR C OXT sing N N 309 TYR CB CG sing N N 310 TYR CB HB2 sing N N 311 TYR CB HB3 sing N N 312 TYR CG CD1 doub Y N 313 TYR CG CD2 sing Y N 314 TYR CD1 CE1 sing Y N 315 TYR CD1 HD1 sing N N 316 TYR CD2 CE2 doub Y N 317 TYR CD2 HD2 sing N N 318 TYR CE1 CZ doub Y N 319 TYR CE1 HE1 sing N N 320 TYR CE2 CZ sing Y N 321 TYR CE2 HE2 sing N N 322 TYR CZ OH sing N N 323 TYR OH HH sing N N 324 TYR OXT HXT sing N N 325 VAL N CA sing N N 326 VAL N H sing N N 327 VAL N H2 sing N N 328 VAL CA C sing N N 329 VAL CA CB sing N N 330 VAL CA HA sing N N 331 VAL C O doub N N 332 VAL C OXT sing N N 333 VAL CB CG1 sing N N 334 VAL CB CG2 sing N N 335 VAL CB HB sing N N 336 VAL CG1 HG11 sing N N 337 VAL CG1 HG12 sing N N 338 VAL CG1 HG13 sing N N 339 VAL CG2 HG21 sing N N 340 VAL CG2 HG22 sing N N 341 VAL CG2 HG23 sing N N 342 VAL OXT HXT sing N N 343 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2DM9 _pdbx_initial_refinement_model.details ? #