data_2DMA
# 
_entry.id   2DMA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.397 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2DMA         pdb_00002dma 10.2210/pdb2dma/pdb 
RCSB  RCSB025581   ?            ?                   
WWPDB D_1000025581 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-01-16 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2023-10-25 
5 'Structure model' 1 4 2023-11-15 
6 'Structure model' 1 5 2024-10-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Derived calculations'      
3  3 'Structure model' 'Source and taxonomy'       
4  3 'Structure model' 'Version format compliance' 
5  4 'Structure model' 'Data collection'           
6  4 'Structure model' 'Database references'       
7  4 'Structure model' 'Derived calculations'      
8  4 'Structure model' 'Refinement description'    
9  5 'Structure model' 'Data collection'           
10 6 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' chem_comp_atom                
2  4 'Structure model' chem_comp_bond                
3  4 'Structure model' database_2                    
4  4 'Structure model' pdbx_initial_refinement_model 
5  4 'Structure model' struct_conn                   
6  4 'Structure model' struct_ref_seq_dif            
7  5 'Structure model' chem_comp_atom                
8  5 'Structure model' chem_comp_bond                
9  6 'Structure model' pdbx_entry_details            
10 6 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
4 4 'Structure model' '_struct_ref_seq_dif.details'         
5 5 'Structure model' '_chem_comp_atom.atom_id'             
6 5 'Structure model' '_chem_comp_bond.atom_id_2'           
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DMA 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-20 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB      2DM9           'the same protein(form I)' unspecified 
TargetDB pho001001978.2 .                          unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lokanath, N.K.'                                         1 
'Kunishima, N.'                                          2 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal Structure of PH1978 from Pyrococcus horikoshii OT3 (form II)'       'To be Published' ?   ?   ?   ?    ?      ?  
?         0353 ? ?        ?                         
1       'Dimeric Core Structure of Modular Stator Subunit E of Archaeal H(+)-ATPase' J.Mol.Biol.       366 933 944 2007 JMOBAK UK 
0022-2836 0070 ? 17189637 10.1016/j.jmb.2006.11.088 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lokanath, N.K.' 1 ? 
primary 'Kunishima, N.'  2 ? 
1       'Lokanath, N.K.' 3 ? 
1       'Matsuura, Y.'   4 ? 
1       'Kuroishi, C.'   5 ? 
1       'Takahashi, N.'  6 ? 
1       'Kunishima, N.'  7 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'V-type ATP synthase subunit E' 23159.746 1  3.6.3.14 ? ? ? 
2 water   nat water                           18.015    77 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'A-ATPase, V-type ATPase subunit E' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)NGAELIIQEINKEAERKIEYILNEARQQAEKIKEEARRNAEAKAEWIIRRAKTQAELEKQRIIANARLEVRRKRL
AIQEEIISSVLEEVKRRLET(MSE)SEDEYFESVKALLKEAIKELNEKKVRV(MSE)SNEKTLGLIASRIEEIKSELGDV
SIELGETVDT(MSE)GGVIVETEDGRIRIDNTFEAR(MSE)ERFEGEIRSTIAKVLFG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNGAELIIQEINKEAERKIEYILNEARQQAEKIKEEARRNAEAKAEWIIRRAKTQAELEKQRIIANARLEVRRKRLAIQE
EIISSVLEEVKRRLETMSEDEYFESVKALLKEAIKELNEKKVRVMSNEKTLGLIASRIEEIKSELGDVSIELGETVDTMG
GVIVETEDGRIRIDNTFEARMERFEGEIRSTIAKVLFG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         pho001001978.2 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   ASN n 
1 3   GLY n 
1 4   ALA n 
1 5   GLU n 
1 6   LEU n 
1 7   ILE n 
1 8   ILE n 
1 9   GLN n 
1 10  GLU n 
1 11  ILE n 
1 12  ASN n 
1 13  LYS n 
1 14  GLU n 
1 15  ALA n 
1 16  GLU n 
1 17  ARG n 
1 18  LYS n 
1 19  ILE n 
1 20  GLU n 
1 21  TYR n 
1 22  ILE n 
1 23  LEU n 
1 24  ASN n 
1 25  GLU n 
1 26  ALA n 
1 27  ARG n 
1 28  GLN n 
1 29  GLN n 
1 30  ALA n 
1 31  GLU n 
1 32  LYS n 
1 33  ILE n 
1 34  LYS n 
1 35  GLU n 
1 36  GLU n 
1 37  ALA n 
1 38  ARG n 
1 39  ARG n 
1 40  ASN n 
1 41  ALA n 
1 42  GLU n 
1 43  ALA n 
1 44  LYS n 
1 45  ALA n 
1 46  GLU n 
1 47  TRP n 
1 48  ILE n 
1 49  ILE n 
1 50  ARG n 
1 51  ARG n 
1 52  ALA n 
1 53  LYS n 
1 54  THR n 
1 55  GLN n 
1 56  ALA n 
1 57  GLU n 
1 58  LEU n 
1 59  GLU n 
1 60  LYS n 
1 61  GLN n 
1 62  ARG n 
1 63  ILE n 
1 64  ILE n 
1 65  ALA n 
1 66  ASN n 
1 67  ALA n 
1 68  ARG n 
1 69  LEU n 
1 70  GLU n 
1 71  VAL n 
1 72  ARG n 
1 73  ARG n 
1 74  LYS n 
1 75  ARG n 
1 76  LEU n 
1 77  ALA n 
1 78  ILE n 
1 79  GLN n 
1 80  GLU n 
1 81  GLU n 
1 82  ILE n 
1 83  ILE n 
1 84  SER n 
1 85  SER n 
1 86  VAL n 
1 87  LEU n 
1 88  GLU n 
1 89  GLU n 
1 90  VAL n 
1 91  LYS n 
1 92  ARG n 
1 93  ARG n 
1 94  LEU n 
1 95  GLU n 
1 96  THR n 
1 97  MSE n 
1 98  SER n 
1 99  GLU n 
1 100 ASP n 
1 101 GLU n 
1 102 TYR n 
1 103 PHE n 
1 104 GLU n 
1 105 SER n 
1 106 VAL n 
1 107 LYS n 
1 108 ALA n 
1 109 LEU n 
1 110 LEU n 
1 111 LYS n 
1 112 GLU n 
1 113 ALA n 
1 114 ILE n 
1 115 LYS n 
1 116 GLU n 
1 117 LEU n 
1 118 ASN n 
1 119 GLU n 
1 120 LYS n 
1 121 LYS n 
1 122 VAL n 
1 123 ARG n 
1 124 VAL n 
1 125 MSE n 
1 126 SER n 
1 127 ASN n 
1 128 GLU n 
1 129 LYS n 
1 130 THR n 
1 131 LEU n 
1 132 GLY n 
1 133 LEU n 
1 134 ILE n 
1 135 ALA n 
1 136 SER n 
1 137 ARG n 
1 138 ILE n 
1 139 GLU n 
1 140 GLU n 
1 141 ILE n 
1 142 LYS n 
1 143 SER n 
1 144 GLU n 
1 145 LEU n 
1 146 GLY n 
1 147 ASP n 
1 148 VAL n 
1 149 SER n 
1 150 ILE n 
1 151 GLU n 
1 152 LEU n 
1 153 GLY n 
1 154 GLU n 
1 155 THR n 
1 156 VAL n 
1 157 ASP n 
1 158 THR n 
1 159 MSE n 
1 160 GLY n 
1 161 GLY n 
1 162 VAL n 
1 163 ILE n 
1 164 VAL n 
1 165 GLU n 
1 166 THR n 
1 167 GLU n 
1 168 ASP n 
1 169 GLY n 
1 170 ARG n 
1 171 ILE n 
1 172 ARG n 
1 173 ILE n 
1 174 ASP n 
1 175 ASN n 
1 176 THR n 
1 177 PHE n 
1 178 GLU n 
1 179 ALA n 
1 180 ARG n 
1 181 MSE n 
1 182 GLU n 
1 183 ARG n 
1 184 PHE n 
1 185 GLU n 
1 186 GLY n 
1 187 GLU n 
1 188 ILE n 
1 189 ARG n 
1 190 SER n 
1 191 THR n 
1 192 ILE n 
1 193 ALA n 
1 194 LYS n 
1 195 VAL n 
1 196 LEU n 
1 197 PHE n 
1 198 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pyrococcus 
_entity_src_gen.pdbx_gene_src_gene                 atpE 
_entity_src_gen.gene_src_species                   'Pyrococcus horikoshii' 
_entity_src_gen.gene_src_strain                    OT3 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pyrococcus horikoshii' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     70601 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 Codon Plus (DE3)-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET11a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   1   ?   ?   ?   A . n 
A 1 2   ASN 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   ALA 4   4   ?   ?   ?   A . n 
A 1 5   GLU 5   5   ?   ?   ?   A . n 
A 1 6   LEU 6   6   ?   ?   ?   A . n 
A 1 7   ILE 7   7   ?   ?   ?   A . n 
A 1 8   ILE 8   8   ?   ?   ?   A . n 
A 1 9   GLN 9   9   ?   ?   ?   A . n 
A 1 10  GLU 10  10  ?   ?   ?   A . n 
A 1 11  ILE 11  11  ?   ?   ?   A . n 
A 1 12  ASN 12  12  ?   ?   ?   A . n 
A 1 13  LYS 13  13  ?   ?   ?   A . n 
A 1 14  GLU 14  14  ?   ?   ?   A . n 
A 1 15  ALA 15  15  ?   ?   ?   A . n 
A 1 16  GLU 16  16  ?   ?   ?   A . n 
A 1 17  ARG 17  17  ?   ?   ?   A . n 
A 1 18  LYS 18  18  ?   ?   ?   A . n 
A 1 19  ILE 19  19  ?   ?   ?   A . n 
A 1 20  GLU 20  20  ?   ?   ?   A . n 
A 1 21  TYR 21  21  ?   ?   ?   A . n 
A 1 22  ILE 22  22  ?   ?   ?   A . n 
A 1 23  LEU 23  23  ?   ?   ?   A . n 
A 1 24  ASN 24  24  ?   ?   ?   A . n 
A 1 25  GLU 25  25  ?   ?   ?   A . n 
A 1 26  ALA 26  26  ?   ?   ?   A . n 
A 1 27  ARG 27  27  ?   ?   ?   A . n 
A 1 28  GLN 28  28  ?   ?   ?   A . n 
A 1 29  GLN 29  29  ?   ?   ?   A . n 
A 1 30  ALA 30  30  ?   ?   ?   A . n 
A 1 31  GLU 31  31  ?   ?   ?   A . n 
A 1 32  LYS 32  32  ?   ?   ?   A . n 
A 1 33  ILE 33  33  ?   ?   ?   A . n 
A 1 34  LYS 34  34  ?   ?   ?   A . n 
A 1 35  GLU 35  35  ?   ?   ?   A . n 
A 1 36  GLU 36  36  ?   ?   ?   A . n 
A 1 37  ALA 37  37  ?   ?   ?   A . n 
A 1 38  ARG 38  38  ?   ?   ?   A . n 
A 1 39  ARG 39  39  ?   ?   ?   A . n 
A 1 40  ASN 40  40  ?   ?   ?   A . n 
A 1 41  ALA 41  41  ?   ?   ?   A . n 
A 1 42  GLU 42  42  ?   ?   ?   A . n 
A 1 43  ALA 43  43  ?   ?   ?   A . n 
A 1 44  LYS 44  44  ?   ?   ?   A . n 
A 1 45  ALA 45  45  ?   ?   ?   A . n 
A 1 46  GLU 46  46  ?   ?   ?   A . n 
A 1 47  TRP 47  47  ?   ?   ?   A . n 
A 1 48  ILE 48  48  ?   ?   ?   A . n 
A 1 49  ILE 49  49  ?   ?   ?   A . n 
A 1 50  ARG 50  50  ?   ?   ?   A . n 
A 1 51  ARG 51  51  ?   ?   ?   A . n 
A 1 52  ALA 52  52  ?   ?   ?   A . n 
A 1 53  LYS 53  53  ?   ?   ?   A . n 
A 1 54  THR 54  54  ?   ?   ?   A . n 
A 1 55  GLN 55  55  ?   ?   ?   A . n 
A 1 56  ALA 56  56  ?   ?   ?   A . n 
A 1 57  GLU 57  57  ?   ?   ?   A . n 
A 1 58  LEU 58  58  ?   ?   ?   A . n 
A 1 59  GLU 59  59  ?   ?   ?   A . n 
A 1 60  LYS 60  60  ?   ?   ?   A . n 
A 1 61  GLN 61  61  ?   ?   ?   A . n 
A 1 62  ARG 62  62  ?   ?   ?   A . n 
A 1 63  ILE 63  63  ?   ?   ?   A . n 
A 1 64  ILE 64  64  ?   ?   ?   A . n 
A 1 65  ALA 65  65  ?   ?   ?   A . n 
A 1 66  ASN 66  66  ?   ?   ?   A . n 
A 1 67  ALA 67  67  ?   ?   ?   A . n 
A 1 68  ARG 68  68  ?   ?   ?   A . n 
A 1 69  LEU 69  69  ?   ?   ?   A . n 
A 1 70  GLU 70  70  ?   ?   ?   A . n 
A 1 71  VAL 71  71  ?   ?   ?   A . n 
A 1 72  ARG 72  72  ?   ?   ?   A . n 
A 1 73  ARG 73  73  ?   ?   ?   A . n 
A 1 74  LYS 74  74  ?   ?   ?   A . n 
A 1 75  ARG 75  75  ?   ?   ?   A . n 
A 1 76  LEU 76  76  ?   ?   ?   A . n 
A 1 77  ALA 77  77  ?   ?   ?   A . n 
A 1 78  ILE 78  78  ?   ?   ?   A . n 
A 1 79  GLN 79  79  ?   ?   ?   A . n 
A 1 80  GLU 80  80  ?   ?   ?   A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  MSE 97  97  97  MSE MSE A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 TYR 102 102 102 TYR TYR A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 MSE 125 125 125 MSE MSE A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 ILE 134 134 134 ILE ILE A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 ILE 141 141 141 ILE ILE A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 SER 149 149 149 SER SER A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 GLY 153 153 153 GLY GLY A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 VAL 156 156 156 VAL VAL A . n 
A 1 157 ASP 157 157 157 ASP ASP A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 MSE 159 159 159 MSE MSE A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 VAL 162 162 162 VAL VAL A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 THR 166 166 166 THR THR A . n 
A 1 167 GLU 167 167 167 GLU GLU A . n 
A 1 168 ASP 168 168 168 ASP ASP A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 ILE 173 173 173 ILE ILE A . n 
A 1 174 ASP 174 174 174 ASP ASP A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 THR 176 176 176 THR THR A . n 
A 1 177 PHE 177 177 177 PHE PHE A . n 
A 1 178 GLU 178 178 178 GLU GLU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 MSE 181 181 181 MSE MSE A . n 
A 1 182 GLU 182 182 182 GLU GLU A . n 
A 1 183 ARG 183 183 183 ARG ARG A . n 
A 1 184 PHE 184 184 184 PHE PHE A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 ILE 188 188 188 ILE ILE A . n 
A 1 189 ARG 189 189 189 ARG ARG A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 THR 191 191 191 THR THR A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 LYS 194 194 194 LYS LYS A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  199 1  HOH HOH A . 
B 2 HOH 2  200 2  HOH HOH A . 
B 2 HOH 3  201 3  HOH HOH A . 
B 2 HOH 4  202 4  HOH HOH A . 
B 2 HOH 5  203 5  HOH HOH A . 
B 2 HOH 6  204 6  HOH HOH A . 
B 2 HOH 7  205 7  HOH HOH A . 
B 2 HOH 8  206 8  HOH HOH A . 
B 2 HOH 9  207 9  HOH HOH A . 
B 2 HOH 10 208 10 HOH HOH A . 
B 2 HOH 11 209 11 HOH HOH A . 
B 2 HOH 12 210 12 HOH HOH A . 
B 2 HOH 13 211 13 HOH HOH A . 
B 2 HOH 14 212 14 HOH HOH A . 
B 2 HOH 15 213 15 HOH HOH A . 
B 2 HOH 16 214 16 HOH HOH A . 
B 2 HOH 17 215 17 HOH HOH A . 
B 2 HOH 18 216 18 HOH HOH A . 
B 2 HOH 19 217 19 HOH HOH A . 
B 2 HOH 20 218 20 HOH HOH A . 
B 2 HOH 21 219 21 HOH HOH A . 
B 2 HOH 22 220 22 HOH HOH A . 
B 2 HOH 23 221 23 HOH HOH A . 
B 2 HOH 24 222 24 HOH HOH A . 
B 2 HOH 25 223 25 HOH HOH A . 
B 2 HOH 26 224 26 HOH HOH A . 
B 2 HOH 27 225 27 HOH HOH A . 
B 2 HOH 28 226 28 HOH HOH A . 
B 2 HOH 29 227 29 HOH HOH A . 
B 2 HOH 30 228 30 HOH HOH A . 
B 2 HOH 31 229 31 HOH HOH A . 
B 2 HOH 32 230 32 HOH HOH A . 
B 2 HOH 33 231 33 HOH HOH A . 
B 2 HOH 34 232 34 HOH HOH A . 
B 2 HOH 35 233 35 HOH HOH A . 
B 2 HOH 36 234 36 HOH HOH A . 
B 2 HOH 37 235 37 HOH HOH A . 
B 2 HOH 38 236 38 HOH HOH A . 
B 2 HOH 39 237 39 HOH HOH A . 
B 2 HOH 40 238 40 HOH HOH A . 
B 2 HOH 41 239 41 HOH HOH A . 
B 2 HOH 42 240 42 HOH HOH A . 
B 2 HOH 43 241 43 HOH HOH A . 
B 2 HOH 44 242 44 HOH HOH A . 
B 2 HOH 45 243 46 HOH HOH A . 
B 2 HOH 46 244 47 HOH HOH A . 
B 2 HOH 47 245 48 HOH HOH A . 
B 2 HOH 48 246 49 HOH HOH A . 
B 2 HOH 49 247 50 HOH HOH A . 
B 2 HOH 50 248 51 HOH HOH A . 
B 2 HOH 51 249 52 HOH HOH A . 
B 2 HOH 52 250 53 HOH HOH A . 
B 2 HOH 53 251 54 HOH HOH A . 
B 2 HOH 54 252 55 HOH HOH A . 
B 2 HOH 55 253 56 HOH HOH A . 
B 2 HOH 56 254 57 HOH HOH A . 
B 2 HOH 57 255 59 HOH HOH A . 
B 2 HOH 58 256 60 HOH HOH A . 
B 2 HOH 59 257 61 HOH HOH A . 
B 2 HOH 60 258 62 HOH HOH A . 
B 2 HOH 61 259 63 HOH HOH A . 
B 2 HOH 62 260 64 HOH HOH A . 
B 2 HOH 63 261 65 HOH HOH A . 
B 2 HOH 64 262 66 HOH HOH A . 
B 2 HOH 65 263 67 HOH HOH A . 
B 2 HOH 66 264 68 HOH HOH A . 
B 2 HOH 67 265 69 HOH HOH A . 
B 2 HOH 68 266 70 HOH HOH A . 
B 2 HOH 69 267 72 HOH HOH A . 
B 2 HOH 70 268 73 HOH HOH A . 
B 2 HOH 71 269 74 HOH HOH A . 
B 2 HOH 72 270 75 HOH HOH A . 
B 2 HOH 73 271 76 HOH HOH A . 
B 2 HOH 74 272 77 HOH HOH A . 
B 2 HOH 75 273 78 HOH HOH A . 
B 2 HOH 76 274 79 HOH HOH A . 
B 2 HOH 77 275 80 HOH HOH A . 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
HKL-2000  'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
_cell.entry_id           2DMA 
_cell.length_a           71.235 
_cell.length_b           78.067 
_cell.length_c           52.829 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2DMA 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
_exptl.entry_id          2DMA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.60 
_exptl_crystal.density_percent_sol   28 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          MICROBATCH 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.pdbx_details    'PEG-MME 550, Bicine-HCl, NaCl, pH 9.0,  microbatch, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS V' 
_diffrn_detector.pdbx_collection_date   2004-10-14 
_diffrn_detector.details                'RH coated bent-cylindrical mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI111 double crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL26B1' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL26B1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     2DMA 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            2.05 
_reflns.number_obs                   9552 
_reflns.number_all                   9568 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.079 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.1 
_reflns.B_iso_Wilson_estimate        14.1 
_reflns.pdbx_redundancy              5.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.05 
_reflns_shell.d_res_low              2.12 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2DMA 
_refine.ls_number_reflns_obs                     9552 
_refine.ls_number_reflns_all                     9568 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2110625.22 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.03 
_refine.ls_d_res_high                            2.05 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.224 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.224 
_refine.ls_R_factor_R_free                       0.261 
_refine.ls_R_factor_R_free_error                 0.012 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.3 
_refine.ls_number_reflns_R_free                  506 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               33.2 
_refine.aniso_B[1][1]                            21.17 
_refine.aniso_B[2][2]                            -9.68 
_refine.aniso_B[3][3]                            -11.49 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.371595 
_refine.solvent_model_param_bsol                 47.3537 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2DM9 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2DMA 
_refine_analyze.Luzzati_coordinate_error_obs    0.26 
_refine_analyze.Luzzati_sigma_a_obs             0.27 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.32 
_refine_analyze.Luzzati_sigma_a_free            0.29 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        937 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             77 
_refine_hist.number_atoms_total               1014 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        39.03 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 20.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.76  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.43  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.21  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        3.12  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       4.46  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.05 
_refine_ls_shell.d_res_low                        2.18 
_refine_ls_shell.number_reflns_R_work             1485 
_refine_ls_shell.R_factor_R_work                  0.29 
_refine_ls_shell.percent_reflns_obs               100.0 
_refine_ls_shell.R_factor_R_free                  0.275 
_refine_ls_shell.R_factor_R_free_error            0.032 
_refine_ls_shell.percent_reflns_R_free            4.7 
_refine_ls_shell.number_reflns_R_free             74 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   water.top   'X-RAY DIFFRACTION' 
3 ion.param         ion.top     'X-RAY DIFFRACTION' 
# 
_database_PDB_matrix.entry_id          2DMA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  2DMA 
_struct.title                     'Crystal Structure of PH1978 from Pyrococcus horikoshii OT3 (form II)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DMA 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;A-ATpase, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VATE_PYRHO 
_struct_ref.pdbx_db_accession          O57724 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNGAELIIQEINKEAERKIEYILNEARQQAEKIKEEARRNAEAKAEWIIRRAKTQAELEKQRIIANARLEVRRKRLAIQE
EIISSVLEEVKRRLETMSEDEYFESVKALLKEAIKELNEKKVRVMSNEKTLGLIASRIEEIKSELGDVSIELGETVDTMG
GVIVETEDGRIRIDNTFEARMERFEGEIRSTIAKVLFG
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2DMA 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 198 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O57724 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  198 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       198 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DMA MSE A 1   ? UNP O57724 MET 1   'modified residue' 1   1 
1 2DMA MSE A 97  ? UNP O57724 MET 97  'modified residue' 97  2 
1 2DMA MSE A 125 ? UNP O57724 MET 125 'modified residue' 125 3 
1 2DMA MSE A 159 ? UNP O57724 MET 159 'modified residue' 159 4 
1 2DMA MSE A 181 ? UNP O57724 MET 181 'modified residue' 181 5 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2710  ? 
1 MORE         -20   ? 
1 'SSA (A^2)'  12010 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 4_556 x,-y,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 52.8290000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 81  ? MSE A 97  ? GLU A 81  MSE A 97  1 ? 17 
HELX_P HELX_P2 2 SER A 98  ? ASN A 118 ? SER A 98  ASN A 118 1 ? 21 
HELX_P HELX_P3 3 ASN A 127 ? ARG A 137 ? ASN A 127 ARG A 137 1 ? 11 
HELX_P HELX_P4 4 ARG A 137 ? GLY A 146 ? ARG A 137 GLY A 146 1 ? 10 
HELX_P HELX_P5 5 PHE A 177 ? PHE A 184 ? PHE A 177 PHE A 184 1 ? 8  
HELX_P HELX_P6 6 PHE A 184 ? GLY A 198 ? PHE A 184 GLY A 198 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A THR 96  C ? ? ? 1_555 A MSE 97  N ? ? A THR 96  A MSE 97  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale2 covale both ? A MSE 97  C ? ? ? 1_555 A SER 98  N ? ? A MSE 97  A SER 98  1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale3 covale both ? A VAL 124 C ? ? ? 1_555 A MSE 125 N ? ? A VAL 124 A MSE 125 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale4 covale both ? A MSE 125 C ? ? ? 1_555 A SER 126 N ? ? A MSE 125 A SER 126 1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale5 covale both ? A THR 158 C ? ? ? 1_555 A MSE 159 N ? ? A THR 158 A MSE 159 1_555 ? ? ? ? ? ? ? 1.324 ? ? 
covale6 covale both ? A MSE 159 C ? ? ? 1_555 A GLY 160 N ? ? A MSE 159 A GLY 160 1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale7 covale both ? A ARG 180 C ? ? ? 1_555 A MSE 181 N ? ? A ARG 180 A MSE 181 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale8 covale both ? A MSE 181 C ? ? ? 1_555 A GLU 182 N ? ? A MSE 181 A GLU 182 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 MSE A 97  ? . . . . MSE A 97  ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
2 MSE A 125 ? . . . . MSE A 125 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
3 MSE A 159 ? . . . . MSE A 159 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
4 MSE A 181 ? . . . . MSE A 181 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 149 ? LEU A 152 ? SER A 149 LEU A 152 
A 2 LYS A 121 ? MSE A 125 ? LYS A 121 MSE A 125 
A 3 GLY A 161 ? THR A 166 ? GLY A 161 THR A 166 
A 4 ARG A 172 ? THR A 176 ? ARG A 172 THR A 176 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER A 149 ? O SER A 149 N VAL A 122 ? N VAL A 122 
A 2 3 N ARG A 123 ? N ARG A 123 O GLU A 165 ? O GLU A 165 
A 3 4 N VAL A 164 ? N VAL A 164 O ILE A 173 ? O ILE A 173 
# 
_pdbx_entry_details.entry_id                   2DMA 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    SER 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     126 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -167.67 
_pdbx_validate_torsion.psi             -168.26 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'NPPSFA, National Project on Protein Structural and Functional Analyses' 
_pdbx_SG_project.full_name_of_center   'RIKEN Structural Genomics/Proteomics Initiative' 
_pdbx_SG_project.initial_of_center     RSGI 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 97  A MSE 97  ? MET SELENOMETHIONINE 
2 A MSE 125 A MSE 125 ? MET SELENOMETHIONINE 
3 A MSE 159 A MSE 159 ? MET SELENOMETHIONINE 
4 A MSE 181 A MSE 181 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     245 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   B 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MSE 1  ? A MSE 1  
2  1 Y 1 A ASN 2  ? A ASN 2  
3  1 Y 1 A GLY 3  ? A GLY 3  
4  1 Y 1 A ALA 4  ? A ALA 4  
5  1 Y 1 A GLU 5  ? A GLU 5  
6  1 Y 1 A LEU 6  ? A LEU 6  
7  1 Y 1 A ILE 7  ? A ILE 7  
8  1 Y 1 A ILE 8  ? A ILE 8  
9  1 Y 1 A GLN 9  ? A GLN 9  
10 1 Y 1 A GLU 10 ? A GLU 10 
11 1 Y 1 A ILE 11 ? A ILE 11 
12 1 Y 1 A ASN 12 ? A ASN 12 
13 1 Y 1 A LYS 13 ? A LYS 13 
14 1 Y 1 A GLU 14 ? A GLU 14 
15 1 Y 1 A ALA 15 ? A ALA 15 
16 1 Y 1 A GLU 16 ? A GLU 16 
17 1 Y 1 A ARG 17 ? A ARG 17 
18 1 Y 1 A LYS 18 ? A LYS 18 
19 1 Y 1 A ILE 19 ? A ILE 19 
20 1 Y 1 A GLU 20 ? A GLU 20 
21 1 Y 1 A TYR 21 ? A TYR 21 
22 1 Y 1 A ILE 22 ? A ILE 22 
23 1 Y 1 A LEU 23 ? A LEU 23 
24 1 Y 1 A ASN 24 ? A ASN 24 
25 1 Y 1 A GLU 25 ? A GLU 25 
26 1 Y 1 A ALA 26 ? A ALA 26 
27 1 Y 1 A ARG 27 ? A ARG 27 
28 1 Y 1 A GLN 28 ? A GLN 28 
29 1 Y 1 A GLN 29 ? A GLN 29 
30 1 Y 1 A ALA 30 ? A ALA 30 
31 1 Y 1 A GLU 31 ? A GLU 31 
32 1 Y 1 A LYS 32 ? A LYS 32 
33 1 Y 1 A ILE 33 ? A ILE 33 
34 1 Y 1 A LYS 34 ? A LYS 34 
35 1 Y 1 A GLU 35 ? A GLU 35 
36 1 Y 1 A GLU 36 ? A GLU 36 
37 1 Y 1 A ALA 37 ? A ALA 37 
38 1 Y 1 A ARG 38 ? A ARG 38 
39 1 Y 1 A ARG 39 ? A ARG 39 
40 1 Y 1 A ASN 40 ? A ASN 40 
41 1 Y 1 A ALA 41 ? A ALA 41 
42 1 Y 1 A GLU 42 ? A GLU 42 
43 1 Y 1 A ALA 43 ? A ALA 43 
44 1 Y 1 A LYS 44 ? A LYS 44 
45 1 Y 1 A ALA 45 ? A ALA 45 
46 1 Y 1 A GLU 46 ? A GLU 46 
47 1 Y 1 A TRP 47 ? A TRP 47 
48 1 Y 1 A ILE 48 ? A ILE 48 
49 1 Y 1 A ILE 49 ? A ILE 49 
50 1 Y 1 A ARG 50 ? A ARG 50 
51 1 Y 1 A ARG 51 ? A ARG 51 
52 1 Y 1 A ALA 52 ? A ALA 52 
53 1 Y 1 A LYS 53 ? A LYS 53 
54 1 Y 1 A THR 54 ? A THR 54 
55 1 Y 1 A GLN 55 ? A GLN 55 
56 1 Y 1 A ALA 56 ? A ALA 56 
57 1 Y 1 A GLU 57 ? A GLU 57 
58 1 Y 1 A LEU 58 ? A LEU 58 
59 1 Y 1 A GLU 59 ? A GLU 59 
60 1 Y 1 A LYS 60 ? A LYS 60 
61 1 Y 1 A GLN 61 ? A GLN 61 
62 1 Y 1 A ARG 62 ? A ARG 62 
63 1 Y 1 A ILE 63 ? A ILE 63 
64 1 Y 1 A ILE 64 ? A ILE 64 
65 1 Y 1 A ALA 65 ? A ALA 65 
66 1 Y 1 A ASN 66 ? A ASN 66 
67 1 Y 1 A ALA 67 ? A ALA 67 
68 1 Y 1 A ARG 68 ? A ARG 68 
69 1 Y 1 A LEU 69 ? A LEU 69 
70 1 Y 1 A GLU 70 ? A GLU 70 
71 1 Y 1 A VAL 71 ? A VAL 71 
72 1 Y 1 A ARG 72 ? A ARG 72 
73 1 Y 1 A ARG 73 ? A ARG 73 
74 1 Y 1 A LYS 74 ? A LYS 74 
75 1 Y 1 A ARG 75 ? A ARG 75 
76 1 Y 1 A LEU 76 ? A LEU 76 
77 1 Y 1 A ALA 77 ? A ALA 77 
78 1 Y 1 A ILE 78 ? A ILE 78 
79 1 Y 1 A GLN 79 ? A GLN 79 
80 1 Y 1 A GLU 80 ? A GLU 80 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
GLN N    N  N N 74  
GLN CA   C  N S 75  
GLN C    C  N N 76  
GLN O    O  N N 77  
GLN CB   C  N N 78  
GLN CG   C  N N 79  
GLN CD   C  N N 80  
GLN OE1  O  N N 81  
GLN NE2  N  N N 82  
GLN OXT  O  N N 83  
GLN H    H  N N 84  
GLN H2   H  N N 85  
GLN HA   H  N N 86  
GLN HB2  H  N N 87  
GLN HB3  H  N N 88  
GLN HG2  H  N N 89  
GLN HG3  H  N N 90  
GLN HE21 H  N N 91  
GLN HE22 H  N N 92  
GLN HXT  H  N N 93  
GLU N    N  N N 94  
GLU CA   C  N S 95  
GLU C    C  N N 96  
GLU O    O  N N 97  
GLU CB   C  N N 98  
GLU CG   C  N N 99  
GLU CD   C  N N 100 
GLU OE1  O  N N 101 
GLU OE2  O  N N 102 
GLU OXT  O  N N 103 
GLU H    H  N N 104 
GLU H2   H  N N 105 
GLU HA   H  N N 106 
GLU HB2  H  N N 107 
GLU HB3  H  N N 108 
GLU HG2  H  N N 109 
GLU HG3  H  N N 110 
GLU HE2  H  N N 111 
GLU HXT  H  N N 112 
GLY N    N  N N 113 
GLY CA   C  N N 114 
GLY C    C  N N 115 
GLY O    O  N N 116 
GLY OXT  O  N N 117 
GLY H    H  N N 118 
GLY H2   H  N N 119 
GLY HA2  H  N N 120 
GLY HA3  H  N N 121 
GLY HXT  H  N N 122 
HOH O    O  N N 123 
HOH H1   H  N N 124 
HOH H2   H  N N 125 
ILE N    N  N N 126 
ILE CA   C  N S 127 
ILE C    C  N N 128 
ILE O    O  N N 129 
ILE CB   C  N S 130 
ILE CG1  C  N N 131 
ILE CG2  C  N N 132 
ILE CD1  C  N N 133 
ILE OXT  O  N N 134 
ILE H    H  N N 135 
ILE H2   H  N N 136 
ILE HA   H  N N 137 
ILE HB   H  N N 138 
ILE HG12 H  N N 139 
ILE HG13 H  N N 140 
ILE HG21 H  N N 141 
ILE HG22 H  N N 142 
ILE HG23 H  N N 143 
ILE HD11 H  N N 144 
ILE HD12 H  N N 145 
ILE HD13 H  N N 146 
ILE HXT  H  N N 147 
LEU N    N  N N 148 
LEU CA   C  N S 149 
LEU C    C  N N 150 
LEU O    O  N N 151 
LEU CB   C  N N 152 
LEU CG   C  N N 153 
LEU CD1  C  N N 154 
LEU CD2  C  N N 155 
LEU OXT  O  N N 156 
LEU H    H  N N 157 
LEU H2   H  N N 158 
LEU HA   H  N N 159 
LEU HB2  H  N N 160 
LEU HB3  H  N N 161 
LEU HG   H  N N 162 
LEU HD11 H  N N 163 
LEU HD12 H  N N 164 
LEU HD13 H  N N 165 
LEU HD21 H  N N 166 
LEU HD22 H  N N 167 
LEU HD23 H  N N 168 
LEU HXT  H  N N 169 
LYS N    N  N N 170 
LYS CA   C  N S 171 
LYS C    C  N N 172 
LYS O    O  N N 173 
LYS CB   C  N N 174 
LYS CG   C  N N 175 
LYS CD   C  N N 176 
LYS CE   C  N N 177 
LYS NZ   N  N N 178 
LYS OXT  O  N N 179 
LYS H    H  N N 180 
LYS H2   H  N N 181 
LYS HA   H  N N 182 
LYS HB2  H  N N 183 
LYS HB3  H  N N 184 
LYS HG2  H  N N 185 
LYS HG3  H  N N 186 
LYS HD2  H  N N 187 
LYS HD3  H  N N 188 
LYS HE2  H  N N 189 
LYS HE3  H  N N 190 
LYS HZ1  H  N N 191 
LYS HZ2  H  N N 192 
LYS HZ3  H  N N 193 
LYS HXT  H  N N 194 
MET N    N  N N 195 
MET CA   C  N S 196 
MET C    C  N N 197 
MET O    O  N N 198 
MET CB   C  N N 199 
MET CG   C  N N 200 
MET SD   S  N N 201 
MET CE   C  N N 202 
MET OXT  O  N N 203 
MET H    H  N N 204 
MET H2   H  N N 205 
MET HA   H  N N 206 
MET HB2  H  N N 207 
MET HB3  H  N N 208 
MET HG2  H  N N 209 
MET HG3  H  N N 210 
MET HE1  H  N N 211 
MET HE2  H  N N 212 
MET HE3  H  N N 213 
MET HXT  H  N N 214 
MSE N    N  N N 215 
MSE CA   C  N S 216 
MSE C    C  N N 217 
MSE O    O  N N 218 
MSE OXT  O  N N 219 
MSE CB   C  N N 220 
MSE CG   C  N N 221 
MSE SE   SE N N 222 
MSE CE   C  N N 223 
MSE H    H  N N 224 
MSE H2   H  N N 225 
MSE HA   H  N N 226 
MSE HXT  H  N N 227 
MSE HB2  H  N N 228 
MSE HB3  H  N N 229 
MSE HG2  H  N N 230 
MSE HG3  H  N N 231 
MSE HE1  H  N N 232 
MSE HE2  H  N N 233 
MSE HE3  H  N N 234 
PHE N    N  N N 235 
PHE CA   C  N S 236 
PHE C    C  N N 237 
PHE O    O  N N 238 
PHE CB   C  N N 239 
PHE CG   C  Y N 240 
PHE CD1  C  Y N 241 
PHE CD2  C  Y N 242 
PHE CE1  C  Y N 243 
PHE CE2  C  Y N 244 
PHE CZ   C  Y N 245 
PHE OXT  O  N N 246 
PHE H    H  N N 247 
PHE H2   H  N N 248 
PHE HA   H  N N 249 
PHE HB2  H  N N 250 
PHE HB3  H  N N 251 
PHE HD1  H  N N 252 
PHE HD2  H  N N 253 
PHE HE1  H  N N 254 
PHE HE2  H  N N 255 
PHE HZ   H  N N 256 
PHE HXT  H  N N 257 
SER N    N  N N 258 
SER CA   C  N S 259 
SER C    C  N N 260 
SER O    O  N N 261 
SER CB   C  N N 262 
SER OG   O  N N 263 
SER OXT  O  N N 264 
SER H    H  N N 265 
SER H2   H  N N 266 
SER HA   H  N N 267 
SER HB2  H  N N 268 
SER HB3  H  N N 269 
SER HG   H  N N 270 
SER HXT  H  N N 271 
THR N    N  N N 272 
THR CA   C  N S 273 
THR C    C  N N 274 
THR O    O  N N 275 
THR CB   C  N R 276 
THR OG1  O  N N 277 
THR CG2  C  N N 278 
THR OXT  O  N N 279 
THR H    H  N N 280 
THR H2   H  N N 281 
THR HA   H  N N 282 
THR HB   H  N N 283 
THR HG1  H  N N 284 
THR HG21 H  N N 285 
THR HG22 H  N N 286 
THR HG23 H  N N 287 
THR HXT  H  N N 288 
TRP N    N  N N 289 
TRP CA   C  N S 290 
TRP C    C  N N 291 
TRP O    O  N N 292 
TRP CB   C  N N 293 
TRP CG   C  Y N 294 
TRP CD1  C  Y N 295 
TRP CD2  C  Y N 296 
TRP NE1  N  Y N 297 
TRP CE2  C  Y N 298 
TRP CE3  C  Y N 299 
TRP CZ2  C  Y N 300 
TRP CZ3  C  Y N 301 
TRP CH2  C  Y N 302 
TRP OXT  O  N N 303 
TRP H    H  N N 304 
TRP H2   H  N N 305 
TRP HA   H  N N 306 
TRP HB2  H  N N 307 
TRP HB3  H  N N 308 
TRP HD1  H  N N 309 
TRP HE1  H  N N 310 
TRP HE3  H  N N 311 
TRP HZ2  H  N N 312 
TRP HZ3  H  N N 313 
TRP HH2  H  N N 314 
TRP HXT  H  N N 315 
TYR N    N  N N 316 
TYR CA   C  N S 317 
TYR C    C  N N 318 
TYR O    O  N N 319 
TYR CB   C  N N 320 
TYR CG   C  Y N 321 
TYR CD1  C  Y N 322 
TYR CD2  C  Y N 323 
TYR CE1  C  Y N 324 
TYR CE2  C  Y N 325 
TYR CZ   C  Y N 326 
TYR OH   O  N N 327 
TYR OXT  O  N N 328 
TYR H    H  N N 329 
TYR H2   H  N N 330 
TYR HA   H  N N 331 
TYR HB2  H  N N 332 
TYR HB3  H  N N 333 
TYR HD1  H  N N 334 
TYR HD2  H  N N 335 
TYR HE1  H  N N 336 
TYR HE2  H  N N 337 
TYR HH   H  N N 338 
TYR HXT  H  N N 339 
VAL N    N  N N 340 
VAL CA   C  N S 341 
VAL C    C  N N 342 
VAL O    O  N N 343 
VAL CB   C  N N 344 
VAL CG1  C  N N 345 
VAL CG2  C  N N 346 
VAL OXT  O  N N 347 
VAL H    H  N N 348 
VAL H2   H  N N 349 
VAL HA   H  N N 350 
VAL HB   H  N N 351 
VAL HG11 H  N N 352 
VAL HG12 H  N N 353 
VAL HG13 H  N N 354 
VAL HG21 H  N N 355 
VAL HG22 H  N N 356 
VAL HG23 H  N N 357 
VAL HXT  H  N N 358 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HOH O   H1   sing N N 116 
HOH O   H2   sing N N 117 
ILE N   CA   sing N N 118 
ILE N   H    sing N N 119 
ILE N   H2   sing N N 120 
ILE CA  C    sing N N 121 
ILE CA  CB   sing N N 122 
ILE CA  HA   sing N N 123 
ILE C   O    doub N N 124 
ILE C   OXT  sing N N 125 
ILE CB  CG1  sing N N 126 
ILE CB  CG2  sing N N 127 
ILE CB  HB   sing N N 128 
ILE CG1 CD1  sing N N 129 
ILE CG1 HG12 sing N N 130 
ILE CG1 HG13 sing N N 131 
ILE CG2 HG21 sing N N 132 
ILE CG2 HG22 sing N N 133 
ILE CG2 HG23 sing N N 134 
ILE CD1 HD11 sing N N 135 
ILE CD1 HD12 sing N N 136 
ILE CD1 HD13 sing N N 137 
ILE OXT HXT  sing N N 138 
LEU N   CA   sing N N 139 
LEU N   H    sing N N 140 
LEU N   H2   sing N N 141 
LEU CA  C    sing N N 142 
LEU CA  CB   sing N N 143 
LEU CA  HA   sing N N 144 
LEU C   O    doub N N 145 
LEU C   OXT  sing N N 146 
LEU CB  CG   sing N N 147 
LEU CB  HB2  sing N N 148 
LEU CB  HB3  sing N N 149 
LEU CG  CD1  sing N N 150 
LEU CG  CD2  sing N N 151 
LEU CG  HG   sing N N 152 
LEU CD1 HD11 sing N N 153 
LEU CD1 HD12 sing N N 154 
LEU CD1 HD13 sing N N 155 
LEU CD2 HD21 sing N N 156 
LEU CD2 HD22 sing N N 157 
LEU CD2 HD23 sing N N 158 
LEU OXT HXT  sing N N 159 
LYS N   CA   sing N N 160 
LYS N   H    sing N N 161 
LYS N   H2   sing N N 162 
LYS CA  C    sing N N 163 
LYS CA  CB   sing N N 164 
LYS CA  HA   sing N N 165 
LYS C   O    doub N N 166 
LYS C   OXT  sing N N 167 
LYS CB  CG   sing N N 168 
LYS CB  HB2  sing N N 169 
LYS CB  HB3  sing N N 170 
LYS CG  CD   sing N N 171 
LYS CG  HG2  sing N N 172 
LYS CG  HG3  sing N N 173 
LYS CD  CE   sing N N 174 
LYS CD  HD2  sing N N 175 
LYS CD  HD3  sing N N 176 
LYS CE  NZ   sing N N 177 
LYS CE  HE2  sing N N 178 
LYS CE  HE3  sing N N 179 
LYS NZ  HZ1  sing N N 180 
LYS NZ  HZ2  sing N N 181 
LYS NZ  HZ3  sing N N 182 
LYS OXT HXT  sing N N 183 
MET N   CA   sing N N 184 
MET N   H    sing N N 185 
MET N   H2   sing N N 186 
MET CA  C    sing N N 187 
MET CA  CB   sing N N 188 
MET CA  HA   sing N N 189 
MET C   O    doub N N 190 
MET C   OXT  sing N N 191 
MET CB  CG   sing N N 192 
MET CB  HB2  sing N N 193 
MET CB  HB3  sing N N 194 
MET CG  SD   sing N N 195 
MET CG  HG2  sing N N 196 
MET CG  HG3  sing N N 197 
MET SD  CE   sing N N 198 
MET CE  HE1  sing N N 199 
MET CE  HE2  sing N N 200 
MET CE  HE3  sing N N 201 
MET OXT HXT  sing N N 202 
MSE N   CA   sing N N 203 
MSE N   H    sing N N 204 
MSE N   H2   sing N N 205 
MSE CA  C    sing N N 206 
MSE CA  CB   sing N N 207 
MSE CA  HA   sing N N 208 
MSE C   O    doub N N 209 
MSE C   OXT  sing N N 210 
MSE OXT HXT  sing N N 211 
MSE CB  CG   sing N N 212 
MSE CB  HB2  sing N N 213 
MSE CB  HB3  sing N N 214 
MSE CG  SE   sing N N 215 
MSE CG  HG2  sing N N 216 
MSE CG  HG3  sing N N 217 
MSE SE  CE   sing N N 218 
MSE CE  HE1  sing N N 219 
MSE CE  HE2  sing N N 220 
MSE CE  HE3  sing N N 221 
PHE N   CA   sing N N 222 
PHE N   H    sing N N 223 
PHE N   H2   sing N N 224 
PHE CA  C    sing N N 225 
PHE CA  CB   sing N N 226 
PHE CA  HA   sing N N 227 
PHE C   O    doub N N 228 
PHE C   OXT  sing N N 229 
PHE CB  CG   sing N N 230 
PHE CB  HB2  sing N N 231 
PHE CB  HB3  sing N N 232 
PHE CG  CD1  doub Y N 233 
PHE CG  CD2  sing Y N 234 
PHE CD1 CE1  sing Y N 235 
PHE CD1 HD1  sing N N 236 
PHE CD2 CE2  doub Y N 237 
PHE CD2 HD2  sing N N 238 
PHE CE1 CZ   doub Y N 239 
PHE CE1 HE1  sing N N 240 
PHE CE2 CZ   sing Y N 241 
PHE CE2 HE2  sing N N 242 
PHE CZ  HZ   sing N N 243 
PHE OXT HXT  sing N N 244 
SER N   CA   sing N N 245 
SER N   H    sing N N 246 
SER N   H2   sing N N 247 
SER CA  C    sing N N 248 
SER CA  CB   sing N N 249 
SER CA  HA   sing N N 250 
SER C   O    doub N N 251 
SER C   OXT  sing N N 252 
SER CB  OG   sing N N 253 
SER CB  HB2  sing N N 254 
SER CB  HB3  sing N N 255 
SER OG  HG   sing N N 256 
SER OXT HXT  sing N N 257 
THR N   CA   sing N N 258 
THR N   H    sing N N 259 
THR N   H2   sing N N 260 
THR CA  C    sing N N 261 
THR CA  CB   sing N N 262 
THR CA  HA   sing N N 263 
THR C   O    doub N N 264 
THR C   OXT  sing N N 265 
THR CB  OG1  sing N N 266 
THR CB  CG2  sing N N 267 
THR CB  HB   sing N N 268 
THR OG1 HG1  sing N N 269 
THR CG2 HG21 sing N N 270 
THR CG2 HG22 sing N N 271 
THR CG2 HG23 sing N N 272 
THR OXT HXT  sing N N 273 
TRP N   CA   sing N N 274 
TRP N   H    sing N N 275 
TRP N   H2   sing N N 276 
TRP CA  C    sing N N 277 
TRP CA  CB   sing N N 278 
TRP CA  HA   sing N N 279 
TRP C   O    doub N N 280 
TRP C   OXT  sing N N 281 
TRP CB  CG   sing N N 282 
TRP CB  HB2  sing N N 283 
TRP CB  HB3  sing N N 284 
TRP CG  CD1  doub Y N 285 
TRP CG  CD2  sing Y N 286 
TRP CD1 NE1  sing Y N 287 
TRP CD1 HD1  sing N N 288 
TRP CD2 CE2  doub Y N 289 
TRP CD2 CE3  sing Y N 290 
TRP NE1 CE2  sing Y N 291 
TRP NE1 HE1  sing N N 292 
TRP CE2 CZ2  sing Y N 293 
TRP CE3 CZ3  doub Y N 294 
TRP CE3 HE3  sing N N 295 
TRP CZ2 CH2  doub Y N 296 
TRP CZ2 HZ2  sing N N 297 
TRP CZ3 CH2  sing Y N 298 
TRP CZ3 HZ3  sing N N 299 
TRP CH2 HH2  sing N N 300 
TRP OXT HXT  sing N N 301 
TYR N   CA   sing N N 302 
TYR N   H    sing N N 303 
TYR N   H2   sing N N 304 
TYR CA  C    sing N N 305 
TYR CA  CB   sing N N 306 
TYR CA  HA   sing N N 307 
TYR C   O    doub N N 308 
TYR C   OXT  sing N N 309 
TYR CB  CG   sing N N 310 
TYR CB  HB2  sing N N 311 
TYR CB  HB3  sing N N 312 
TYR CG  CD1  doub Y N 313 
TYR CG  CD2  sing Y N 314 
TYR CD1 CE1  sing Y N 315 
TYR CD1 HD1  sing N N 316 
TYR CD2 CE2  doub Y N 317 
TYR CD2 HD2  sing N N 318 
TYR CE1 CZ   doub Y N 319 
TYR CE1 HE1  sing N N 320 
TYR CE2 CZ   sing Y N 321 
TYR CE2 HE2  sing N N 322 
TYR CZ  OH   sing N N 323 
TYR OH  HH   sing N N 324 
TYR OXT HXT  sing N N 325 
VAL N   CA   sing N N 326 
VAL N   H    sing N N 327 
VAL N   H2   sing N N 328 
VAL CA  C    sing N N 329 
VAL CA  CB   sing N N 330 
VAL CA  HA   sing N N 331 
VAL C   O    doub N N 332 
VAL C   OXT  sing N N 333 
VAL CB  CG1  sing N N 334 
VAL CB  CG2  sing N N 335 
VAL CB  HB   sing N N 336 
VAL CG1 HG11 sing N N 337 
VAL CG1 HG12 sing N N 338 
VAL CG1 HG13 sing N N 339 
VAL CG2 HG21 sing N N 340 
VAL CG2 HG22 sing N N 341 
VAL CG2 HG23 sing N N 342 
VAL OXT HXT  sing N N 343 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   2DM9 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    2DMA 
_atom_sites.fract_transf_matrix[1][1]   0.014038 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012810 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018929 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
SE 
# 
loop_