data_2DMJ # _entry.id 2DMJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DMJ pdb_00002dmj 10.2210/pdb2dmj/pdb RCSB RCSB025590 ? ? WWPDB D_1000025590 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DMJ _pdbx_database_status.recvd_initial_deposition_date 2006-04-21 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nagashima, T.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the first zf-PARP domain of human Poly(ADP-ribose)polymerase-1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nagashima, T.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'poly (ADP-ribose) polymerase family, member 1' 11665.087 1 2.4.2.30 ? zf-parp ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Poly (ADP-ribose) polymerase-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGMAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDG FSELRWDDQQKVKKTAEAGGSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGMAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDG FSELRWDDQQKVKKTAEAGGSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 ALA n 1 10 GLU n 1 11 SER n 1 12 SER n 1 13 ASP n 1 14 LYS n 1 15 LEU n 1 16 TYR n 1 17 ARG n 1 18 VAL n 1 19 GLU n 1 20 TYR n 1 21 ALA n 1 22 LYS n 1 23 SER n 1 24 GLY n 1 25 ARG n 1 26 ALA n 1 27 SER n 1 28 CYS n 1 29 LYS n 1 30 LYS n 1 31 CYS n 1 32 SER n 1 33 GLU n 1 34 SER n 1 35 ILE n 1 36 PRO n 1 37 LYS n 1 38 ASP n 1 39 SER n 1 40 LEU n 1 41 ARG n 1 42 MET n 1 43 ALA n 1 44 ILE n 1 45 MET n 1 46 VAL n 1 47 GLN n 1 48 SER n 1 49 PRO n 1 50 MET n 1 51 PHE n 1 52 ASP n 1 53 GLY n 1 54 LYS n 1 55 VAL n 1 56 PRO n 1 57 HIS n 1 58 TRP n 1 59 TYR n 1 60 HIS n 1 61 PHE n 1 62 SER n 1 63 CYS n 1 64 PHE n 1 65 TRP n 1 66 LYS n 1 67 VAL n 1 68 GLY n 1 69 HIS n 1 70 SER n 1 71 ILE n 1 72 ARG n 1 73 HIS n 1 74 PRO n 1 75 ASP n 1 76 VAL n 1 77 GLU n 1 78 VAL n 1 79 ASP n 1 80 GLY n 1 81 PHE n 1 82 SER n 1 83 GLU n 1 84 LEU n 1 85 ARG n 1 86 TRP n 1 87 ASP n 1 88 ASP n 1 89 GLN n 1 90 GLN n 1 91 LYS n 1 92 VAL n 1 93 LYS n 1 94 LYS n 1 95 THR n 1 96 ALA n 1 97 GLU n 1 98 ALA n 1 99 GLY n 1 100 GLY n 1 101 SER n 1 102 GLY n 1 103 PRO n 1 104 SER n 1 105 SER n 1 106 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'PARP1, ADPRT, PPOL' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050516-17 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code CAH70217 _struct_ref.pdbx_db_accession 55663673 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWD DQQKVKKTAEAGG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DMJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 100 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 55663673 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 93 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 100 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DMJ GLY A 1 ? GB 55663673 ? ? 'cloning artifact' 1 1 1 2DMJ SER A 2 ? GB 55663673 ? ? 'cloning artifact' 2 2 1 2DMJ SER A 3 ? GB 55663673 ? ? 'cloning artifact' 3 3 1 2DMJ GLY A 4 ? GB 55663673 ? ? 'cloning artifact' 4 4 1 2DMJ SER A 5 ? GB 55663673 ? ? 'cloning artifact' 5 5 1 2DMJ SER A 6 ? GB 55663673 ? ? 'cloning artifact' 6 6 1 2DMJ GLY A 7 ? GB 55663673 ? ? 'cloning artifact' 7 7 1 2DMJ SER A 101 ? GB 55663673 ? ? 'cloning artifact' 101 8 1 2DMJ GLY A 102 ? GB 55663673 ? ? 'cloning artifact' 102 9 1 2DMJ PRO A 103 ? GB 55663673 ? ? 'cloning artifact' 103 10 1 2DMJ SER A 104 ? GB 55663673 ? ? 'cloning artifact' 104 11 1 2DMJ SER A 105 ? GB 55663673 ? ? 'cloning artifact' 105 12 1 2DMJ GLY A 106 ? GB 55663673 ? ? 'cloning artifact' 106 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.02mM uniformly 13C, 15N labeled protein; 20mM malonic acid, 100mM NaCl, 0.1mM DTT, 0.02% NaN3, 0.05mM ZnCl2, 1mM NTA; 10% D2O, 90% H2O ; _pdbx_nmr_sample_details.solvent_system '10% D2O, 90% H2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DMJ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DMJ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DMJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20020425 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9318 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DMJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DMJ _struct.title 'Solution structure of the first zf-PARP domain of human Poly(ADP-ribose)polymerase-1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DMJ _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;zinc finger, PARP-1, ADPRT, NAD(+) ADP-ribosyltransferase 1, Poly(ADP-ribose) synthetase 1, DNA nick sensor, DNA repair, transcription, XRCC1, DNA ligase III, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 62 ? VAL A 67 ? SER A 62 VAL A 67 1 ? 6 HELX_P HELX_P2 2 ARG A 85 ? GLY A 99 ? ARG A 85 GLY A 99 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 28 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 200 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc2 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 200 1_555 ? ? ? ? ? ? ? 2.343 ? ? metalc3 metalc ? ? A HIS 60 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 60 A ZN 200 1_555 ? ? ? ? ? ? ? 2.081 ? ? metalc4 metalc ? ? A CYS 63 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 63 A ZN 200 1_555 ? ? ? ? ? ? ? 2.247 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 16 ? ARG A 17 ? TYR A 16 ARG A 17 A 2 VAL A 78 ? ASP A 79 ? VAL A 78 ASP A 79 B 1 GLU A 19 ? TYR A 20 ? GLU A 19 TYR A 20 B 2 LEU A 40 ? SER A 48 ? LEU A 40 SER A 48 B 3 GLY A 53 ? HIS A 60 ? GLY A 53 HIS A 60 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 16 ? N TYR A 16 O ASP A 79 ? O ASP A 79 B 1 2 N GLU A 19 ? N GLU A 19 O ARG A 41 ? O ARG A 41 B 2 3 N ILE A 44 ? N ILE A 44 O HIS A 57 ? O HIS A 57 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 200 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 200' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 28 ? CYS A 28 . ? 1_555 ? 2 AC1 4 CYS A 31 ? CYS A 31 . ? 1_555 ? 3 AC1 4 HIS A 60 ? HIS A 60 . ? 1_555 ? 4 AC1 4 CYS A 63 ? CYS A 63 . ? 1_555 ? # _database_PDB_matrix.entry_id 2DMJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DMJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 TRP 65 65 65 TRP TRP A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLY 106 106 106 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 200 _pdbx_nonpoly_scheme.auth_seq_num 200 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 108.2 ? 2 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 ND1 ? A HIS 60 ? A HIS 60 ? 1_555 108.1 ? 3 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 ND1 ? A HIS 60 ? A HIS 60 ? 1_555 104.2 ? 4 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 63 ? A CYS 63 ? 1_555 104.9 ? 5 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 63 ? A CYS 63 ? 1_555 113.3 ? 6 ND1 ? A HIS 60 ? A HIS 60 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 63 ? A CYS 63 ? 1_555 117.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-04-24 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_ref_seq_dif.details' 29 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 13 ? ? -81.89 45.79 2 1 ALA A 21 ? ? -35.91 143.68 3 1 LYS A 30 ? ? -132.20 -43.02 4 1 HIS A 60 ? ? -49.56 157.63 5 1 PRO A 103 ? ? -69.70 4.29 6 1 SER A 104 ? ? -43.21 91.33 7 2 ALA A 21 ? ? -39.68 132.24 8 2 LYS A 29 ? ? -99.32 30.59 9 2 LYS A 30 ? ? -131.61 -53.29 10 2 ASP A 52 ? ? -92.34 39.86 11 2 PHE A 61 ? ? -34.02 -33.76 12 2 LEU A 84 ? ? -44.00 153.79 13 2 PRO A 103 ? ? -69.69 97.01 14 2 SER A 105 ? ? -56.66 98.54 15 3 SER A 12 ? ? -161.54 114.61 16 3 ALA A 21 ? ? -35.12 114.63 17 3 LYS A 30 ? ? -133.66 -48.75 18 3 ASP A 52 ? ? 33.26 35.99 19 3 PHE A 61 ? ? -33.69 -37.89 20 3 PRO A 103 ? ? -69.75 91.16 21 4 MET A 8 ? ? -38.95 126.28 22 4 SER A 12 ? ? 38.49 39.25 23 4 ALA A 21 ? ? -33.84 122.67 24 4 SER A 32 ? ? 72.80 49.30 25 5 SER A 3 ? ? -161.26 114.42 26 5 SER A 11 ? ? -90.15 44.82 27 5 ALA A 21 ? ? -33.33 141.63 28 5 LYS A 30 ? ? -133.34 -54.25 29 5 SER A 32 ? ? 39.98 54.99 30 5 ASP A 38 ? ? 38.97 48.33 31 5 ASP A 52 ? ? -98.79 38.58 32 5 PHE A 61 ? ? -36.22 -32.47 33 5 ARG A 72 ? ? -62.44 -70.20 34 5 LEU A 84 ? ? -47.08 157.63 35 5 PRO A 103 ? ? -69.80 -174.46 36 6 SER A 3 ? ? -174.48 125.29 37 6 ALA A 9 ? ? -170.40 112.16 38 6 ASP A 13 ? ? -89.12 47.50 39 6 LYS A 30 ? ? -135.00 -54.36 40 6 SER A 32 ? ? 72.29 46.45 41 6 ASP A 52 ? ? -97.11 42.11 42 6 PHE A 61 ? ? -39.62 -31.87 43 6 PRO A 103 ? ? -69.80 -173.80 44 7 ASP A 13 ? ? -97.37 41.85 45 7 ALA A 26 ? ? -37.27 124.58 46 7 LYS A 30 ? ? -130.80 -53.41 47 7 PHE A 61 ? ? -35.97 -30.83 48 8 SER A 11 ? ? -134.29 -37.47 49 8 ALA A 21 ? ? -33.50 113.05 50 8 ALA A 26 ? ? -46.97 157.40 51 8 LYS A 30 ? ? -131.90 -53.41 52 8 ASP A 52 ? ? -78.25 46.16 53 8 LEU A 84 ? ? -46.68 169.92 54 9 SER A 6 ? ? -87.60 42.17 55 9 GLU A 10 ? ? -36.61 106.98 56 9 ALA A 21 ? ? -33.44 111.80 57 9 LYS A 29 ? ? -98.72 32.04 58 9 LYS A 30 ? ? -131.60 -50.54 59 9 ASP A 52 ? ? -78.65 45.11 60 9 PRO A 103 ? ? -69.80 5.49 61 10 LYS A 14 ? ? -53.55 177.40 62 10 ALA A 21 ? ? -33.86 127.96 63 10 LYS A 29 ? ? -98.07 33.27 64 10 LYS A 30 ? ? -132.58 -51.13 65 10 PRO A 49 ? ? -69.79 3.13 66 10 ASP A 52 ? ? -83.61 44.77 67 10 PHE A 61 ? ? -35.56 -35.80 68 10 PHE A 64 ? ? -38.46 -37.67 69 10 PRO A 103 ? ? -69.81 11.40 70 10 SER A 104 ? ? -43.18 167.01 71 11 SER A 12 ? ? -165.55 107.74 72 11 ASP A 13 ? ? -85.10 42.52 73 11 ALA A 21 ? ? -33.53 141.12 74 11 ALA A 26 ? ? -33.62 147.92 75 11 LYS A 29 ? ? -99.34 31.92 76 11 LYS A 30 ? ? -132.71 -54.72 77 11 PRO A 49 ? ? -69.79 3.79 78 11 ASP A 52 ? ? -90.60 44.14 79 11 PHE A 61 ? ? -35.76 -35.04 80 11 HIS A 69 ? ? -33.37 104.16 81 11 SER A 101 ? ? -38.68 123.75 82 12 ASP A 13 ? ? -84.42 46.85 83 12 LYS A 30 ? ? -133.99 -45.12 84 12 ASP A 52 ? ? 34.83 32.32 85 12 HIS A 69 ? ? -107.77 49.25 86 12 SER A 70 ? ? -49.18 163.09 87 13 GLU A 10 ? ? -79.28 45.04 88 13 ASP A 13 ? ? -109.62 49.24 89 13 ALA A 21 ? ? -39.06 125.48 90 13 LYS A 29 ? ? -95.28 37.35 91 13 LYS A 30 ? ? -134.99 -49.26 92 13 SER A 32 ? ? 73.62 48.70 93 13 ASP A 52 ? ? -97.32 41.15 94 13 LEU A 84 ? ? -45.38 155.40 95 13 SER A 101 ? ? -65.84 95.47 96 14 SER A 3 ? ? -174.61 128.10 97 14 ALA A 21 ? ? -33.26 143.25 98 14 ASP A 52 ? ? -77.89 45.44 99 14 SER A 101 ? ? -171.79 120.82 100 14 SER A 104 ? ? 35.86 41.80 101 15 ALA A 21 ? ? -36.56 140.92 102 15 PRO A 49 ? ? -69.74 0.21 103 15 ASP A 52 ? ? -87.12 45.93 104 15 ARG A 72 ? ? -71.20 -73.47 105 15 LEU A 84 ? ? -46.74 163.55 106 16 SER A 5 ? ? -79.31 44.79 107 16 GLU A 10 ? ? -96.57 42.26 108 16 LYS A 29 ? ? -95.66 35.01 109 16 LYS A 30 ? ? -135.05 -52.91 110 16 ASP A 52 ? ? -103.48 41.47 111 16 PRO A 103 ? ? -69.78 -179.46 112 16 SER A 104 ? ? -83.40 42.41 113 16 SER A 105 ? ? -37.23 151.30 114 17 SER A 11 ? ? -45.07 101.78 115 17 ALA A 21 ? ? -34.58 139.57 116 17 LYS A 29 ? ? -98.38 31.08 117 17 LYS A 30 ? ? -130.48 -54.90 118 17 SER A 32 ? ? 71.19 54.15 119 17 ASP A 52 ? ? -101.17 41.92 120 17 PHE A 61 ? ? -39.07 -37.90 121 17 SER A 101 ? ? -59.08 103.24 122 18 ALA A 21 ? ? -33.08 137.52 123 18 SER A 32 ? ? 38.11 54.93 124 18 PHE A 61 ? ? -39.52 -34.85 125 18 HIS A 69 ? ? -91.29 45.61 126 18 SER A 70 ? ? -49.08 150.09 127 18 LEU A 84 ? ? -45.05 170.83 128 19 SER A 11 ? ? -80.18 44.22 129 19 ALA A 21 ? ? -34.22 117.08 130 19 ARG A 25 ? ? -103.92 -60.15 131 19 ALA A 26 ? ? -39.10 126.73 132 19 LYS A 29 ? ? -99.04 32.74 133 19 LYS A 30 ? ? -132.66 -51.28 134 19 PHE A 61 ? ? -37.91 -33.74 135 19 HIS A 69 ? ? -109.52 50.66 136 19 SER A 70 ? ? -46.57 163.18 137 19 LEU A 84 ? ? -49.48 153.69 138 19 LYS A 93 ? ? -52.70 -70.14 139 19 PRO A 103 ? ? -69.75 6.25 140 20 ALA A 21 ? ? -38.17 130.09 141 20 ARG A 25 ? ? -101.22 -60.81 142 20 ALA A 26 ? ? -34.53 136.77 143 20 LYS A 30 ? ? -133.67 -52.02 144 20 ASP A 52 ? ? -76.92 46.97 145 20 PHE A 61 ? ? -34.00 -32.86 146 20 PRO A 74 ? ? -69.82 3.21 147 20 PRO A 103 ? ? -69.77 86.67 148 20 SER A 105 ? ? -40.89 103.77 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #