data_2DZI # _entry.id 2DZI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DZI pdb_00002dzi 10.2210/pdb2dzi/pdb RCSB RCSB026036 ? ? WWPDB D_1000026036 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-03-29 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DZI _pdbx_database_status.recvd_initial_deposition_date 2006-09-29 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001002639.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhao, C.' 1 'Sato, M.' 2 'Koshiba, S.' 3 'Watanabe, S.' 4 'Harada, T.' 5 'Kigawa, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title '2DZI/Solution Structure of the N-terminal Ubiquitin-like Domain in Human Ubiquitin-like Protein 4A (GDX)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhao, C.' 1 ? primary 'Sato, M.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Watanabe, S.' 4 ? primary 'Harada, T.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ubiquitin-like protein 4A' _entity.formula_weight 8762.168 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'ubiquitin-like domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ubiquitin-like protein GDX' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGMQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKP L ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGMQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKP L ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001002639.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 GLN n 1 10 LEU n 1 11 THR n 1 12 VAL n 1 13 LYS n 1 14 ALA n 1 15 LEU n 1 16 GLN n 1 17 GLY n 1 18 ARG n 1 19 GLU n 1 20 CYS n 1 21 SER n 1 22 LEU n 1 23 GLN n 1 24 VAL n 1 25 PRO n 1 26 GLU n 1 27 ASP n 1 28 GLU n 1 29 LEU n 1 30 VAL n 1 31 SER n 1 32 THR n 1 33 LEU n 1 34 LYS n 1 35 GLN n 1 36 LEU n 1 37 VAL n 1 38 SER n 1 39 GLU n 1 40 LYS n 1 41 LEU n 1 42 ASN n 1 43 VAL n 1 44 PRO n 1 45 VAL n 1 46 ARG n 1 47 GLN n 1 48 GLN n 1 49 ARG n 1 50 LEU n 1 51 LEU n 1 52 PHE n 1 53 LYS n 1 54 GLY n 1 55 LYS n 1 56 ALA n 1 57 LEU n 1 58 ALA n 1 59 ASP n 1 60 GLY n 1 61 LYS n 1 62 ARG n 1 63 LEU n 1 64 SER n 1 65 ASP n 1 66 TYR n 1 67 SER n 1 68 ILE n 1 69 GLY n 1 70 PRO n 1 71 ASN n 1 72 SER n 1 73 LYS n 1 74 LEU n 1 75 ASN n 1 76 LEU n 1 77 VAL n 1 78 VAL n 1 79 LYS n 1 80 PRO n 1 81 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'UBL4A, DXS254E, GDX, UBL4' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060227-19 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 LEU 81 81 81 LEU LEU A . n # _exptl.entry_id 2DZI _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2DZI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2DZI _struct.title '2DZI/Solution Structure of the N-terminal Ubiquitin-like Domain in Human Ubiquitin-like Protein 4A (GDX)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DZI _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;ubiquitin-like protein 4A, GDX, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UBL4A_HUMAN _struct_ref.pdbx_db_accession P11441 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPL _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DZI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P11441 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 74 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 81 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DZI GLY A 1 ? UNP P11441 ? ? 'cloning artifact' 1 1 1 2DZI SER A 2 ? UNP P11441 ? ? 'cloning artifact' 2 2 1 2DZI SER A 3 ? UNP P11441 ? ? 'cloning artifact' 3 3 1 2DZI GLY A 4 ? UNP P11441 ? ? 'cloning artifact' 4 4 1 2DZI SER A 5 ? UNP P11441 ? ? 'cloning artifact' 5 5 1 2DZI SER A 6 ? UNP P11441 ? ? 'cloning artifact' 6 6 1 2DZI GLY A 7 ? UNP P11441 ? ? 'cloning artifact' 7 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 29 ? LEU A 41 ? LEU A 29 LEU A 41 1 ? 13 HELX_P HELX_P2 2 ARG A 62 ? SER A 67 ? ARG A 62 SER A 67 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 19 ? VAL A 24 ? GLU A 19 VAL A 24 A 2 MET A 8 ? ALA A 14 ? MET A 8 ALA A 14 A 3 ASN A 75 ? VAL A 77 ? ASN A 75 VAL A 77 A 4 ARG A 49 ? PHE A 52 ? ARG A 49 PHE A 52 A 5 LYS A 55 ? ALA A 56 ? LYS A 55 ALA A 56 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 22 ? O LEU A 22 N LEU A 10 ? N LEU A 10 A 2 3 N LYS A 13 ? N LYS A 13 O LEU A 76 ? O LEU A 76 A 3 4 O ASN A 75 ? O ASN A 75 N LEU A 51 ? N LEU A 51 A 4 5 N PHE A 52 ? N PHE A 52 O LYS A 55 ? O LYS A 55 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 15 ? ? -45.95 107.68 2 1 CYS A 20 ? ? -174.10 148.21 3 1 PRO A 25 ? ? -69.71 -170.42 4 1 GLN A 47 ? ? -92.00 -68.64 5 1 ASP A 59 ? ? -51.74 101.35 6 1 SER A 67 ? ? 73.59 36.52 7 2 LEU A 15 ? ? -40.08 100.39 8 2 PRO A 25 ? ? -69.69 -177.40 9 2 GLN A 47 ? ? -92.29 -74.39 10 3 GLN A 47 ? ? -106.90 -73.57 11 3 ASP A 59 ? ? -43.45 108.21 12 4 SER A 2 ? ? -37.09 126.45 13 4 LEU A 15 ? ? -44.88 99.34 14 4 GLN A 16 ? ? 37.63 40.84 15 4 CYS A 20 ? ? -174.61 144.28 16 4 GLN A 47 ? ? -114.55 -70.01 17 5 SER A 2 ? ? -57.08 93.17 18 5 SER A 6 ? ? -47.12 150.73 19 5 GLN A 47 ? ? -93.94 -70.96 20 6 SER A 5 ? ? -121.90 -61.37 21 6 LEU A 15 ? ? -37.76 122.17 22 6 GLN A 16 ? ? 35.55 43.45 23 6 GLN A 47 ? ? -96.53 -69.97 24 7 LEU A 15 ? ? -34.70 127.60 25 7 GLN A 16 ? ? 35.24 44.99 26 7 CYS A 20 ? ? -171.64 144.49 27 7 PRO A 25 ? ? -69.78 -179.38 28 7 LYS A 61 ? ? -56.66 178.53 29 8 LEU A 15 ? ? -38.05 111.50 30 8 CYS A 20 ? ? -170.75 139.88 31 8 PRO A 25 ? ? -69.75 -176.14 32 8 GLN A 47 ? ? -83.63 -73.94 33 8 ASP A 59 ? ? -55.52 105.29 34 9 ASP A 27 ? ? -84.35 30.67 35 9 ASN A 42 ? ? 74.16 31.46 36 9 GLN A 47 ? ? -102.22 -71.77 37 9 GLN A 48 ? ? -37.31 140.55 38 9 LYS A 53 ? ? 46.96 27.28 39 10 SER A 67 ? ? 73.12 40.25 40 10 PRO A 70 ? ? -69.77 -178.92 41 11 SER A 6 ? ? -42.25 104.59 42 11 LEU A 15 ? ? -42.17 109.91 43 11 GLN A 16 ? ? 37.47 39.24 44 11 GLN A 47 ? ? -113.41 -74.87 45 12 LYS A 40 ? ? -60.93 -71.13 46 12 GLN A 47 ? ? -78.03 -74.49 47 12 ASP A 59 ? ? -37.20 -33.58 48 12 LYS A 61 ? ? -57.11 175.41 49 13 SER A 2 ? ? -106.09 42.10 50 13 PRO A 25 ? ? -69.71 -178.85 51 13 GLN A 47 ? ? -101.96 -74.60 52 14 LEU A 15 ? ? -50.07 100.71 53 14 CYS A 20 ? ? -171.75 138.33 54 14 GLN A 47 ? ? -104.15 -71.53 55 14 PRO A 70 ? ? -69.77 -178.20 56 14 ASN A 71 ? ? 38.51 40.80 57 15 CYS A 20 ? ? -174.53 146.31 58 15 GLN A 47 ? ? -84.22 -74.86 59 15 GLN A 48 ? ? -39.75 145.05 60 16 GLN A 16 ? ? 35.79 37.35 61 16 GLN A 47 ? ? -78.60 -71.17 62 17 LEU A 15 ? ? -45.34 98.64 63 17 GLN A 16 ? ? 35.33 37.00 64 17 PRO A 25 ? ? -69.73 -177.05 65 17 GLN A 47 ? ? -88.62 -73.94 66 17 LYS A 61 ? ? -56.03 179.43 67 18 PRO A 25 ? ? -69.75 -179.76 68 18 GLN A 47 ? ? -86.71 -75.01 69 18 GLN A 48 ? ? -38.81 128.74 70 18 LYS A 61 ? ? -64.93 -179.43 71 18 LYS A 79 ? ? -48.76 153.81 72 19 SER A 2 ? ? 34.42 51.77 73 19 LEU A 15 ? ? -42.86 100.47 74 19 GLN A 47 ? ? -94.79 -69.63 75 19 LYS A 61 ? ? -59.61 -179.00 76 19 PRO A 70 ? ? -69.74 -179.93 77 20 CYS A 20 ? ? -172.05 139.08 78 20 GLN A 47 ? ? -107.76 -60.40 79 20 LYS A 61 ? ? -61.31 -175.52 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2DZI _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DZI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.18mM ubiquitin-like domain U-15N, 13C; 20mM d-Tris-HCl (pH7.0), 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2DZI _pdbx_nmr_refine.method 'torsion angle dynamics, restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9748 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PHE N N N N 226 PHE CA C N S 227 PHE C C N N 228 PHE O O N N 229 PHE CB C N N 230 PHE CG C Y N 231 PHE CD1 C Y N 232 PHE CD2 C Y N 233 PHE CE1 C Y N 234 PHE CE2 C Y N 235 PHE CZ C Y N 236 PHE OXT O N N 237 PHE H H N N 238 PHE H2 H N N 239 PHE HA H N N 240 PHE HB2 H N N 241 PHE HB3 H N N 242 PHE HD1 H N N 243 PHE HD2 H N N 244 PHE HE1 H N N 245 PHE HE2 H N N 246 PHE HZ H N N 247 PHE HXT H N N 248 PRO N N N N 249 PRO CA C N S 250 PRO C C N N 251 PRO O O N N 252 PRO CB C N N 253 PRO CG C N N 254 PRO CD C N N 255 PRO OXT O N N 256 PRO H H N N 257 PRO HA H N N 258 PRO HB2 H N N 259 PRO HB3 H N N 260 PRO HG2 H N N 261 PRO HG3 H N N 262 PRO HD2 H N N 263 PRO HD3 H N N 264 PRO HXT H N N 265 SER N N N N 266 SER CA C N S 267 SER C C N N 268 SER O O N N 269 SER CB C N N 270 SER OG O N N 271 SER OXT O N N 272 SER H H N N 273 SER H2 H N N 274 SER HA H N N 275 SER HB2 H N N 276 SER HB3 H N N 277 SER HG H N N 278 SER HXT H N N 279 THR N N N N 280 THR CA C N S 281 THR C C N N 282 THR O O N N 283 THR CB C N R 284 THR OG1 O N N 285 THR CG2 C N N 286 THR OXT O N N 287 THR H H N N 288 THR H2 H N N 289 THR HA H N N 290 THR HB H N N 291 THR HG1 H N N 292 THR HG21 H N N 293 THR HG22 H N N 294 THR HG23 H N N 295 THR HXT H N N 296 TYR N N N N 297 TYR CA C N S 298 TYR C C N N 299 TYR O O N N 300 TYR CB C N N 301 TYR CG C Y N 302 TYR CD1 C Y N 303 TYR CD2 C Y N 304 TYR CE1 C Y N 305 TYR CE2 C Y N 306 TYR CZ C Y N 307 TYR OH O N N 308 TYR OXT O N N 309 TYR H H N N 310 TYR H2 H N N 311 TYR HA H N N 312 TYR HB2 H N N 313 TYR HB3 H N N 314 TYR HD1 H N N 315 TYR HD2 H N N 316 TYR HE1 H N N 317 TYR HE2 H N N 318 TYR HH H N N 319 TYR HXT H N N 320 VAL N N N N 321 VAL CA C N S 322 VAL C C N N 323 VAL O O N N 324 VAL CB C N N 325 VAL CG1 C N N 326 VAL CG2 C N N 327 VAL OXT O N N 328 VAL H H N N 329 VAL H2 H N N 330 VAL HA H N N 331 VAL HB H N N 332 VAL HG11 H N N 333 VAL HG12 H N N 334 VAL HG13 H N N 335 VAL HG21 H N N 336 VAL HG22 H N N 337 VAL HG23 H N N 338 VAL HXT H N N 339 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TYR N CA sing N N 283 TYR N H sing N N 284 TYR N H2 sing N N 285 TYR CA C sing N N 286 TYR CA CB sing N N 287 TYR CA HA sing N N 288 TYR C O doub N N 289 TYR C OXT sing N N 290 TYR CB CG sing N N 291 TYR CB HB2 sing N N 292 TYR CB HB3 sing N N 293 TYR CG CD1 doub Y N 294 TYR CG CD2 sing Y N 295 TYR CD1 CE1 sing Y N 296 TYR CD1 HD1 sing N N 297 TYR CD2 CE2 doub Y N 298 TYR CD2 HD2 sing N N 299 TYR CE1 CZ doub Y N 300 TYR CE1 HE1 sing N N 301 TYR CE2 CZ sing Y N 302 TYR CE2 HE2 sing N N 303 TYR CZ OH sing N N 304 TYR OH HH sing N N 305 TYR OXT HXT sing N N 306 VAL N CA sing N N 307 VAL N H sing N N 308 VAL N H2 sing N N 309 VAL CA C sing N N 310 VAL CA CB sing N N 311 VAL CA HA sing N N 312 VAL C O doub N N 313 VAL C OXT sing N N 314 VAL CB CG1 sing N N 315 VAL CB CG2 sing N N 316 VAL CB HB sing N N 317 VAL CG1 HG11 sing N N 318 VAL CG1 HG12 sing N N 319 VAL CG1 HG13 sing N N 320 VAL CG2 HG21 sing N N 321 VAL CG2 HG22 sing N N 322 VAL CG2 HG23 sing N N 323 VAL OXT HXT sing N N 324 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2DZI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_