data_2EC4 # _entry.id 2EC4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EC4 pdb_00002ec4 10.2210/pdb2ec4/pdb RCSB RCSB026485 ? ? WWPDB D_1000026485 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-03-04 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EC4 _pdbx_database_status.recvd_initial_deposition_date 2007-02-09 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002005135.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, H.P.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the UAS domain from human FAS-associated factor 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, H.P.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'FAS-associated factor 1' _entity.formula_weight 20134.734 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UAS domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein FAF1, hFAF1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCA ESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELM MRLMAAMEIFTAQQQEDI ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCA ESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELM MRLMAAMEIFTAQQQEDI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002005135.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 ASN n 1 10 ALA n 1 11 GLU n 1 12 ASN n 1 13 GLU n 1 14 GLY n 1 15 ASP n 1 16 ALA n 1 17 LEU n 1 18 LEU n 1 19 GLN n 1 20 PHE n 1 21 THR n 1 22 ALA n 1 23 GLU n 1 24 PHE n 1 25 SER n 1 26 SER n 1 27 ARG n 1 28 TYR n 1 29 GLY n 1 30 ASP n 1 31 CYS n 1 32 HIS n 1 33 PRO n 1 34 VAL n 1 35 PHE n 1 36 PHE n 1 37 ILE n 1 38 GLY n 1 39 SER n 1 40 LEU n 1 41 GLU n 1 42 ALA n 1 43 ALA n 1 44 PHE n 1 45 GLN n 1 46 GLU n 1 47 ALA n 1 48 PHE n 1 49 TYR n 1 50 VAL n 1 51 LYS n 1 52 ALA n 1 53 ARG n 1 54 ASP n 1 55 ARG n 1 56 LYS n 1 57 LEU n 1 58 LEU n 1 59 ALA n 1 60 ILE n 1 61 TYR n 1 62 LEU n 1 63 HIS n 1 64 HIS n 1 65 ASP n 1 66 GLU n 1 67 SER n 1 68 VAL n 1 69 LEU n 1 70 THR n 1 71 ASN n 1 72 VAL n 1 73 PHE n 1 74 CYS n 1 75 SER n 1 76 GLN n 1 77 MET n 1 78 LEU n 1 79 CYS n 1 80 ALA n 1 81 GLU n 1 82 SER n 1 83 ILE n 1 84 VAL n 1 85 SER n 1 86 TYR n 1 87 LEU n 1 88 SER n 1 89 GLN n 1 90 ASN n 1 91 PHE n 1 92 ILE n 1 93 THR n 1 94 TRP n 1 95 ALA n 1 96 TRP n 1 97 ASP n 1 98 LEU n 1 99 THR n 1 100 LYS n 1 101 ASP n 1 102 SER n 1 103 ASN n 1 104 ARG n 1 105 ALA n 1 106 ARG n 1 107 PHE n 1 108 LEU n 1 109 THR n 1 110 MET n 1 111 CYS n 1 112 ASN n 1 113 ARG n 1 114 HIS n 1 115 PHE n 1 116 GLY n 1 117 SER n 1 118 VAL n 1 119 VAL n 1 120 ALA n 1 121 GLN n 1 122 THR n 1 123 ILE n 1 124 ARG n 1 125 THR n 1 126 GLN n 1 127 LYS n 1 128 THR n 1 129 ASP n 1 130 GLN n 1 131 PHE n 1 132 PRO n 1 133 LEU n 1 134 PHE n 1 135 LEU n 1 136 ILE n 1 137 ILE n 1 138 MET n 1 139 GLY n 1 140 LYS n 1 141 ARG n 1 142 SER n 1 143 SER n 1 144 ASN n 1 145 GLU n 1 146 VAL n 1 147 LEU n 1 148 ASN n 1 149 VAL n 1 150 ILE n 1 151 GLN n 1 152 GLY n 1 153 ASN n 1 154 THR n 1 155 THR n 1 156 VAL n 1 157 ASP n 1 158 GLU n 1 159 LEU n 1 160 MET n 1 161 MET n 1 162 ARG n 1 163 LEU n 1 164 MET n 1 165 ALA n 1 166 ALA n 1 167 MET n 1 168 GLU n 1 169 ILE n 1 170 PHE n 1 171 THR n 1 172 ALA n 1 173 GLN n 1 174 GLN n 1 175 GLN n 1 176 GLU n 1 177 ASP n 1 178 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene FAF1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060619-01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 GLY 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 SER 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 TRP 94 94 94 TRP TRP A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 MET 110 110 110 MET MET A . n A 1 111 CYS 111 111 111 CYS CYS A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 GLN 130 130 130 GLN GLN A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 MET 138 138 138 MET MET A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 MET 160 160 160 MET MET A . n A 1 161 MET 161 161 161 MET MET A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 MET 164 164 164 MET MET A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 MET 167 167 167 MET MET A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 GLN 175 175 175 GLN GLN A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 ILE 178 178 178 ILE ILE A . n # _exptl.entry_id 2EC4 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2EC4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2EC4 _struct.title 'Solution structure of the UAS domain from human FAS-associated factor 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EC4 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;UAS domain, FAS-associated factor 1, Protein FAF1, hFAF1, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FAF1_HUMAN _struct_ref.pdbx_db_accession Q9UNN5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYL SQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAM EIFTAQQQEDI ; _struct_ref.pdbx_align_begin 325 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EC4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 178 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UNN5 _struct_ref_seq.db_align_beg 325 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 495 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 178 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EC4 GLY A 1 ? UNP Q9UNN5 ? ? 'expression tag' 1 1 1 2EC4 SER A 2 ? UNP Q9UNN5 ? ? 'expression tag' 2 2 1 2EC4 SER A 3 ? UNP Q9UNN5 ? ? 'expression tag' 3 3 1 2EC4 GLY A 4 ? UNP Q9UNN5 ? ? 'expression tag' 4 4 1 2EC4 SER A 5 ? UNP Q9UNN5 ? ? 'expression tag' 5 5 1 2EC4 SER A 6 ? UNP Q9UNN5 ? ? 'expression tag' 6 6 1 2EC4 GLY A 7 ? UNP Q9UNN5 ? ? 'expression tag' 7 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 12 ? GLY A 29 ? ASN A 12 GLY A 29 1 ? 18 HELX_P HELX_P2 2 SER A 39 ? GLU A 46 ? SER A 39 GLU A 46 1 ? 8 HELX_P HELX_P3 3 VAL A 68 ? MET A 77 ? VAL A 68 MET A 77 1 ? 10 HELX_P HELX_P4 4 ALA A 80 ? ASN A 90 ? ALA A 80 ASN A 90 1 ? 11 HELX_P HELX_P5 5 LYS A 100 ? PHE A 115 ? LYS A 100 PHE A 115 1 ? 16 HELX_P HELX_P6 6 GLY A 116 ? GLN A 126 ? GLY A 116 GLN A 126 1 ? 11 HELX_P HELX_P7 7 THR A 155 ? GLN A 174 ? THR A 155 GLN A 174 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 1 -0.01 2 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 2 0.09 3 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 3 -0.02 4 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 4 0.03 5 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 5 0.02 6 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 6 -0.03 7 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 7 -0.04 8 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 8 -0.04 9 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 9 0.00 10 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 10 0.00 11 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 11 -0.05 12 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 12 -0.02 13 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 13 0.04 14 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 14 0.00 15 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 15 -0.09 16 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 16 0.03 17 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 17 0.02 18 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 18 -0.07 19 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 19 0.04 20 PHE 131 A . ? PHE 131 A PRO 132 A ? PRO 132 A 20 0.01 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 91 ? ASP A 97 ? PHE A 91 ASP A 97 A 2 LEU A 57 ? HIS A 63 ? LEU A 57 HIS A 63 A 3 LEU A 133 ? ILE A 137 ? LEU A 133 ILE A 137 A 4 VAL A 146 ? ILE A 150 ? VAL A 146 ILE A 150 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TRP A 94 ? O TRP A 94 N TYR A 61 ? N TYR A 61 A 2 3 N LEU A 58 ? N LEU A 58 O ILE A 137 ? O ILE A 137 A 3 4 N ILE A 136 ? N ILE A 136 O LEU A 147 ? O LEU A 147 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 70 ? ? -36.47 -30.11 2 1 ARG A 113 ? ? -94.44 -61.92 3 1 PHE A 115 ? ? -95.32 -60.99 4 1 LYS A 127 ? ? -52.40 176.92 5 1 VAL A 156 ? ? -35.88 -35.71 6 2 CYS A 31 ? ? -52.12 108.16 7 2 VAL A 34 ? ? -52.11 108.20 8 2 ALA A 47 ? ? -97.99 -66.91 9 2 LYS A 51 ? ? -52.00 179.90 10 2 PHE A 73 ? ? -45.56 -19.94 11 2 MET A 77 ? ? -97.92 -68.74 12 2 ILE A 83 ? ? -94.79 -69.01 13 2 VAL A 84 ? ? -38.30 -28.71 14 2 VAL A 119 ? ? -91.07 -63.17 15 2 ARG A 141 ? ? -36.01 -30.57 16 2 LEU A 147 ? ? -96.07 -62.76 17 2 VAL A 156 ? ? -34.95 -35.63 18 3 CYS A 31 ? ? -54.62 102.87 19 3 GLU A 46 ? ? -57.55 -9.96 20 3 PHE A 115 ? ? -92.63 -68.29 21 3 LYS A 127 ? ? -59.21 177.09 22 3 MET A 138 ? ? -97.68 -62.50 23 3 SER A 142 ? ? -97.84 -66.83 24 3 LEU A 147 ? ? -93.96 -62.86 25 3 GLN A 174 ? ? -52.08 177.93 26 4 TYR A 28 ? ? -91.65 -67.74 27 4 CYS A 31 ? ? -52.87 107.43 28 4 VAL A 34 ? ? -56.63 106.32 29 4 ALA A 43 ? ? -34.82 -35.45 30 4 PHE A 48 ? ? -98.02 -68.13 31 4 VAL A 50 ? ? -53.79 171.27 32 4 ASP A 54 ? ? -90.93 -70.36 33 4 LYS A 56 ? ? -52.40 176.15 34 4 PHE A 73 ? ? -37.83 -35.84 35 4 PHE A 115 ? ? -97.56 -68.05 36 4 PRO A 132 ? ? -69.79 -178.09 37 4 ARG A 141 ? ? -33.19 -37.25 38 5 ALA A 80 ? ? -52.10 102.07 39 5 SER A 82 ? ? -48.31 -19.15 40 5 ILE A 83 ? ? -98.06 -69.42 41 5 VAL A 84 ? ? -36.87 -30.65 42 5 ARG A 113 ? ? -93.77 -66.90 43 6 TYR A 28 ? ? -94.67 -62.85 44 6 CYS A 31 ? ? -52.15 108.11 45 6 ILE A 83 ? ? -78.40 -70.02 46 6 ARG A 113 ? ? -90.72 -68.23 47 6 PHE A 115 ? ? -94.18 -62.60 48 6 LYS A 127 ? ? -55.60 176.38 49 6 MET A 138 ? ? -97.91 -68.56 50 6 ASP A 177 ? ? -95.96 -62.91 51 7 GLN A 19 ? ? -90.48 -61.24 52 7 TYR A 28 ? ? -96.91 -64.89 53 7 CYS A 31 ? ? -52.44 109.98 54 7 GLU A 46 ? ? -46.90 -19.77 55 7 PHE A 48 ? ? -97.58 -65.14 56 7 TYR A 49 ? ? -32.84 -35.23 57 7 VAL A 50 ? ? -59.77 171.77 58 7 HIS A 114 ? ? -88.91 -70.55 59 7 VAL A 118 ? ? -39.35 -36.38 60 7 LYS A 127 ? ? -57.04 171.52 61 7 GLN A 130 ? ? -36.54 -33.82 62 8 ASN A 9 ? ? -95.50 -61.36 63 8 TYR A 28 ? ? -95.42 -65.54 64 8 VAL A 34 ? ? -52.56 173.38 65 8 ALA A 43 ? ? -37.49 -37.15 66 8 PHE A 48 ? ? -97.89 -68.69 67 8 TYR A 49 ? ? -33.80 -34.48 68 8 VAL A 50 ? ? -56.99 173.72 69 8 PHE A 73 ? ? -34.25 -32.38 70 8 MET A 77 ? ? -89.02 -72.86 71 8 ALA A 120 ? ? -39.38 -28.37 72 8 THR A 122 ? ? -37.72 -36.31 73 8 MET A 138 ? ? -91.39 -65.44 74 8 ARG A 141 ? ? -39.21 -25.99 75 8 ALA A 166 ? ? -34.82 -32.84 76 9 CYS A 31 ? ? -52.09 103.08 77 9 ALA A 43 ? ? -34.09 -36.45 78 9 PHE A 48 ? ? -98.03 -70.50 79 9 LYS A 51 ? ? -56.18 174.06 80 9 CYS A 111 ? ? -38.95 -28.84 81 9 ALA A 120 ? ? -34.21 -37.46 82 9 PRO A 132 ? ? -69.75 -177.08 83 9 ALA A 166 ? ? -34.63 -36.83 84 10 TYR A 28 ? ? -92.37 -65.85 85 10 VAL A 34 ? ? -57.98 102.50 86 10 GLU A 46 ? ? -49.55 -16.87 87 10 PHE A 48 ? ? -97.98 -65.18 88 10 TYR A 49 ? ? -33.07 -38.17 89 10 VAL A 50 ? ? -52.20 178.99 90 10 GLU A 66 ? ? -38.30 -37.21 91 10 MET A 77 ? ? -97.45 -69.14 92 10 HIS A 114 ? ? -95.92 -67.70 93 10 LYS A 127 ? ? -53.20 170.11 94 10 PRO A 132 ? ? -69.79 -177.19 95 11 TYR A 28 ? ? -90.43 -67.12 96 11 ALA A 43 ? ? -36.09 -29.96 97 11 PHE A 48 ? ? -94.45 -70.25 98 11 TYR A 49 ? ? -34.74 -32.92 99 11 VAL A 50 ? ? -52.08 170.99 100 11 PHE A 73 ? ? -38.93 -29.67 101 11 ALA A 80 ? ? -56.62 102.31 102 11 PHE A 115 ? ? -94.18 -68.42 103 11 PRO A 132 ? ? -69.75 -177.27 104 11 GLU A 176 ? ? -51.99 102.26 105 12 TYR A 28 ? ? -92.51 -63.34 106 12 VAL A 34 ? ? -55.13 109.09 107 12 GLU A 46 ? ? -58.45 -1.85 108 12 VAL A 50 ? ? -64.83 -72.64 109 12 ARG A 55 ? ? -57.50 108.47 110 12 MET A 77 ? ? -94.02 -70.94 111 12 ARG A 113 ? ? -94.85 -66.11 112 12 PHE A 115 ? ? -92.83 -63.02 113 12 PRO A 132 ? ? -69.76 -178.03 114 13 ARG A 27 ? ? -39.19 -37.63 115 13 TYR A 28 ? ? -94.43 -64.91 116 13 ALA A 47 ? ? -98.00 -66.28 117 13 VAL A 50 ? ? -55.46 174.36 118 13 LYS A 51 ? ? -58.72 171.55 119 13 THR A 70 ? ? -32.92 -33.47 120 13 SER A 142 ? ? -73.34 -72.91 121 13 LEU A 147 ? ? -97.91 -67.99 122 14 TYR A 28 ? ? -90.71 -64.34 123 14 ALA A 47 ? ? -97.93 -61.03 124 14 ASN A 71 ? ? -34.31 -33.21 125 14 MET A 77 ? ? -79.67 -71.21 126 14 VAL A 84 ? ? -36.93 -30.71 127 14 ARG A 113 ? ? -91.11 -60.62 128 14 PHE A 115 ? ? -90.92 -65.03 129 14 GLN A 126 ? ? -52.75 104.90 130 15 TYR A 28 ? ? -97.85 -63.34 131 15 CYS A 31 ? ? -53.02 107.81 132 15 VAL A 34 ? ? -53.55 102.73 133 15 ALA A 43 ? ? -48.03 -18.53 134 15 PHE A 48 ? ? -97.60 -64.41 135 15 VAL A 50 ? ? -33.76 -76.79 136 15 GLU A 66 ? ? -34.49 -39.83 137 15 MET A 77 ? ? -91.41 -68.89 138 15 ILE A 83 ? ? -90.53 -67.45 139 15 ARG A 113 ? ? -94.39 -65.91 140 15 LEU A 147 ? ? -97.86 -66.72 141 16 ARG A 27 ? ? -95.90 -63.42 142 16 VAL A 34 ? ? -53.16 102.17 143 16 PHE A 48 ? ? -97.00 -67.64 144 16 TYR A 49 ? ? -37.94 -32.89 145 16 PHE A 115 ? ? -92.51 -66.21 146 16 PRO A 132 ? ? -69.79 -178.46 147 17 PHE A 24 ? ? -37.76 -39.04 148 17 TYR A 28 ? ? -95.66 -67.68 149 17 VAL A 34 ? ? -53.97 107.74 150 17 PHE A 36 ? ? -58.94 108.61 151 17 ALA A 47 ? ? -97.93 -60.99 152 17 PHE A 48 ? ? -96.85 -65.65 153 17 TYR A 49 ? ? -35.76 -38.54 154 17 VAL A 50 ? ? -32.15 -73.36 155 17 ALA A 52 ? ? -49.81 -15.70 156 17 ARG A 55 ? ? -55.79 102.10 157 17 ARG A 113 ? ? -94.73 -68.31 158 17 LYS A 127 ? ? -56.34 173.74 159 18 ARG A 27 ? ? -97.96 -63.62 160 18 VAL A 34 ? ? -52.74 105.14 161 18 ALA A 43 ? ? -33.60 -36.32 162 18 MET A 77 ? ? -89.96 -70.04 163 18 ILE A 83 ? ? -79.03 -71.39 164 18 VAL A 84 ? ? -36.58 -32.78 165 18 PRO A 132 ? ? -69.67 -176.18 166 18 SER A 142 ? ? -93.48 -64.62 167 19 CYS A 31 ? ? -52.04 103.17 168 19 VAL A 34 ? ? -52.04 102.00 169 19 ALA A 43 ? ? -34.64 -37.78 170 19 GLU A 46 ? ? -68.92 1.67 171 19 ALA A 80 ? ? -52.03 109.17 172 19 ILE A 83 ? ? -71.66 -70.76 173 19 VAL A 118 ? ? -36.78 -37.11 174 19 VAL A 156 ? ? -38.15 -37.02 175 20 CYS A 31 ? ? -53.01 103.65 176 20 PHE A 36 ? ? -58.16 106.86 177 20 ALA A 80 ? ? -56.03 102.29 178 20 PHE A 115 ? ? -90.61 -68.17 179 20 LYS A 127 ? ? -58.06 175.11 180 20 ARG A 141 ? ? -36.81 -32.93 181 20 LEU A 147 ? ? -95.88 -61.98 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2EC4 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EC4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.78mM 13C, 15N-labeled protein; 20mM d-Tris-HCl (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2EC4 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.04 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9818 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntent, P.' 5 refinement CYANA 2.0.17 'Guntent, P.' 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A GLY 4 ? A GLY 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A SER 6 ? A SER 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 2 Y 1 A GLY 1 ? A GLY 1 9 2 Y 1 A SER 2 ? A SER 2 10 2 Y 1 A SER 3 ? A SER 3 11 2 Y 1 A GLY 4 ? A GLY 4 12 2 Y 1 A SER 5 ? A SER 5 13 2 Y 1 A SER 6 ? A SER 6 14 2 Y 1 A GLY 7 ? A GLY 7 15 3 Y 1 A GLY 1 ? A GLY 1 16 3 Y 1 A SER 2 ? A SER 2 17 3 Y 1 A SER 3 ? A SER 3 18 3 Y 1 A GLY 4 ? A GLY 4 19 3 Y 1 A SER 5 ? A SER 5 20 3 Y 1 A SER 6 ? A SER 6 21 3 Y 1 A GLY 7 ? A GLY 7 22 4 Y 1 A GLY 1 ? A GLY 1 23 4 Y 1 A SER 2 ? A SER 2 24 4 Y 1 A SER 3 ? A SER 3 25 4 Y 1 A GLY 4 ? A GLY 4 26 4 Y 1 A SER 5 ? A SER 5 27 4 Y 1 A SER 6 ? A SER 6 28 4 Y 1 A GLY 7 ? A GLY 7 29 5 Y 1 A GLY 1 ? A GLY 1 30 5 Y 1 A SER 2 ? A SER 2 31 5 Y 1 A SER 3 ? A SER 3 32 5 Y 1 A GLY 4 ? A GLY 4 33 5 Y 1 A SER 5 ? A SER 5 34 5 Y 1 A SER 6 ? A SER 6 35 5 Y 1 A GLY 7 ? A GLY 7 36 6 Y 1 A GLY 1 ? A GLY 1 37 6 Y 1 A SER 2 ? A SER 2 38 6 Y 1 A SER 3 ? A SER 3 39 6 Y 1 A GLY 4 ? A GLY 4 40 6 Y 1 A SER 5 ? A SER 5 41 6 Y 1 A SER 6 ? A SER 6 42 6 Y 1 A GLY 7 ? A GLY 7 43 7 Y 1 A GLY 1 ? A GLY 1 44 7 Y 1 A SER 2 ? A SER 2 45 7 Y 1 A SER 3 ? A SER 3 46 7 Y 1 A GLY 4 ? A GLY 4 47 7 Y 1 A SER 5 ? A SER 5 48 7 Y 1 A SER 6 ? A SER 6 49 7 Y 1 A GLY 7 ? A GLY 7 50 8 Y 1 A GLY 1 ? A GLY 1 51 8 Y 1 A SER 2 ? A SER 2 52 8 Y 1 A SER 3 ? A SER 3 53 8 Y 1 A GLY 4 ? A GLY 4 54 8 Y 1 A SER 5 ? A SER 5 55 8 Y 1 A SER 6 ? A SER 6 56 8 Y 1 A GLY 7 ? A GLY 7 57 9 Y 1 A GLY 1 ? A GLY 1 58 9 Y 1 A SER 2 ? A SER 2 59 9 Y 1 A SER 3 ? A SER 3 60 9 Y 1 A GLY 4 ? A GLY 4 61 9 Y 1 A SER 5 ? A SER 5 62 9 Y 1 A SER 6 ? A SER 6 63 9 Y 1 A GLY 7 ? A GLY 7 64 10 Y 1 A GLY 1 ? A GLY 1 65 10 Y 1 A SER 2 ? A SER 2 66 10 Y 1 A SER 3 ? A SER 3 67 10 Y 1 A GLY 4 ? A GLY 4 68 10 Y 1 A SER 5 ? A SER 5 69 10 Y 1 A SER 6 ? A SER 6 70 10 Y 1 A GLY 7 ? A GLY 7 71 11 Y 1 A GLY 1 ? A GLY 1 72 11 Y 1 A SER 2 ? A SER 2 73 11 Y 1 A SER 3 ? A SER 3 74 11 Y 1 A GLY 4 ? A GLY 4 75 11 Y 1 A SER 5 ? A SER 5 76 11 Y 1 A SER 6 ? A SER 6 77 11 Y 1 A GLY 7 ? A GLY 7 78 12 Y 1 A GLY 1 ? A GLY 1 79 12 Y 1 A SER 2 ? A SER 2 80 12 Y 1 A SER 3 ? A SER 3 81 12 Y 1 A GLY 4 ? A GLY 4 82 12 Y 1 A SER 5 ? A SER 5 83 12 Y 1 A SER 6 ? A SER 6 84 12 Y 1 A GLY 7 ? A GLY 7 85 13 Y 1 A GLY 1 ? A GLY 1 86 13 Y 1 A SER 2 ? A SER 2 87 13 Y 1 A SER 3 ? A SER 3 88 13 Y 1 A GLY 4 ? A GLY 4 89 13 Y 1 A SER 5 ? A SER 5 90 13 Y 1 A SER 6 ? A SER 6 91 13 Y 1 A GLY 7 ? A GLY 7 92 14 Y 1 A GLY 1 ? A GLY 1 93 14 Y 1 A SER 2 ? A SER 2 94 14 Y 1 A SER 3 ? A SER 3 95 14 Y 1 A GLY 4 ? A GLY 4 96 14 Y 1 A SER 5 ? A SER 5 97 14 Y 1 A SER 6 ? A SER 6 98 14 Y 1 A GLY 7 ? A GLY 7 99 15 Y 1 A GLY 1 ? A GLY 1 100 15 Y 1 A SER 2 ? A SER 2 101 15 Y 1 A SER 3 ? A SER 3 102 15 Y 1 A GLY 4 ? A GLY 4 103 15 Y 1 A SER 5 ? A SER 5 104 15 Y 1 A SER 6 ? A SER 6 105 15 Y 1 A GLY 7 ? A GLY 7 106 16 Y 1 A GLY 1 ? A GLY 1 107 16 Y 1 A SER 2 ? A SER 2 108 16 Y 1 A SER 3 ? A SER 3 109 16 Y 1 A GLY 4 ? A GLY 4 110 16 Y 1 A SER 5 ? A SER 5 111 16 Y 1 A SER 6 ? A SER 6 112 16 Y 1 A GLY 7 ? A GLY 7 113 17 Y 1 A GLY 1 ? A GLY 1 114 17 Y 1 A SER 2 ? A SER 2 115 17 Y 1 A SER 3 ? A SER 3 116 17 Y 1 A GLY 4 ? A GLY 4 117 17 Y 1 A SER 5 ? A SER 5 118 17 Y 1 A SER 6 ? A SER 6 119 17 Y 1 A GLY 7 ? A GLY 7 120 18 Y 1 A GLY 1 ? A GLY 1 121 18 Y 1 A SER 2 ? A SER 2 122 18 Y 1 A SER 3 ? A SER 3 123 18 Y 1 A GLY 4 ? A GLY 4 124 18 Y 1 A SER 5 ? A SER 5 125 18 Y 1 A SER 6 ? A SER 6 126 18 Y 1 A GLY 7 ? A GLY 7 127 19 Y 1 A GLY 1 ? A GLY 1 128 19 Y 1 A SER 2 ? A SER 2 129 19 Y 1 A SER 3 ? A SER 3 130 19 Y 1 A GLY 4 ? A GLY 4 131 19 Y 1 A SER 5 ? A SER 5 132 19 Y 1 A SER 6 ? A SER 6 133 19 Y 1 A GLY 7 ? A GLY 7 134 20 Y 1 A GLY 1 ? A GLY 1 135 20 Y 1 A SER 2 ? A SER 2 136 20 Y 1 A SER 3 ? A SER 3 137 20 Y 1 A GLY 4 ? A GLY 4 138 20 Y 1 A SER 5 ? A SER 5 139 20 Y 1 A SER 6 ? A SER 6 140 20 Y 1 A GLY 7 ? A GLY 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 800 ? 2 INOVA Varian 900 ? # _atom_sites.entry_id 2EC4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_