data_2ECJ # _entry.id 2ECJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2ECJ pdb_00002ecj 10.2210/pdb2ecj/pdb RCSB RCSB026498 ? ? WWPDB D_1000026498 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002005913.3 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2ECJ _pdbx_database_status.recvd_initial_deposition_date 2007-02-13 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Miyamoto, K.' 1 'Sato, M.' 2 'Koshiba, S.' 3 'Watanabe, S.' 4 'Harada, T.' 5 'Kigawa, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the RING domain of the human tripartite motif-containing protein 39' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Miyamoto, K.' 1 ? primary 'Sato, M.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Watanabe, S.' 4 ? primary 'Harada, T.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Yokoyama, S.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tripartite motif-containing protein 39' 6429.298 1 ? ? 'RING domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RING finger protein 23, Testis-abundant finger protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVC _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002005913.3 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ALA n 1 9 LEU n 1 10 GLU n 1 11 ASN n 1 12 LEU n 1 13 GLN n 1 14 VAL n 1 15 GLU n 1 16 ALA n 1 17 SER n 1 18 CYS n 1 19 SER n 1 20 VAL n 1 21 CYS n 1 22 LEU n 1 23 GLU n 1 24 TYR n 1 25 LEU n 1 26 LYS n 1 27 GLU n 1 28 PRO n 1 29 VAL n 1 30 ILE n 1 31 ILE n 1 32 GLU n 1 33 CYS n 1 34 GLY n 1 35 HIS n 1 36 ASN n 1 37 PHE n 1 38 CYS n 1 39 LYS n 1 40 ALA n 1 41 CYS n 1 42 ILE n 1 43 THR n 1 44 ARG n 1 45 TRP n 1 46 TRP n 1 47 GLU n 1 48 ASP n 1 49 LEU n 1 50 GLU n 1 51 ARG n 1 52 ASP n 1 53 PHE n 1 54 PRO n 1 55 CYS n 1 56 PRO n 1 57 VAL n 1 58 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene TRIM39 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060828-17 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRI39_HUMAN _struct_ref.pdbx_db_accession Q9HCM9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVC _struct_ref.pdbx_align_begin 19 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ECJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 58 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HCM9 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 69 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 58 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2ECJ GLY A 1 ? UNP Q9HCM9 ? ? 'cloning artifact' 1 1 1 2ECJ SER A 2 ? UNP Q9HCM9 ? ? 'cloning artifact' 2 2 1 2ECJ SER A 3 ? UNP Q9HCM9 ? ? 'cloning artifact' 3 3 1 2ECJ GLY A 4 ? UNP Q9HCM9 ? ? 'cloning artifact' 4 4 1 2ECJ SER A 5 ? UNP Q9HCM9 ? ? 'cloning artifact' 5 5 1 2ECJ SER A 6 ? UNP Q9HCM9 ? ? 'cloning artifact' 6 6 1 2ECJ GLY A 7 ? UNP Q9HCM9 ? ? 'cloning artifact' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.06mM RING domain U-13C, 15N; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZNCl2; 1.0mM IDA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2ECJ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2ECJ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2ECJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2ECJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2ECJ _struct.title 'Solution structure of the RING domain of the human tripartite motif-containing protein 39' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ECJ _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;Tripartite motif-containing protein 39, TRIM39, RING domain, zinc-binding domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 38 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TRP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 46 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 38 _struct_conf.end_auth_comp_id TRP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 46 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.196 ? ? metalc3 metalc ? ? A CYS 33 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 33 A ZN 401 1_555 ? ? ? ? ? ? ? 2.192 ? ? metalc4 metalc ? ? A HIS 35 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 35 A ZN 401 1_555 ? ? ? ? ? ? ? 2.068 ? ? metalc5 metalc ? ? A CYS 38 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 38 A ZN 201 1_555 ? ? ? ? ? ? ? 2.385 ? ? metalc6 metalc ? ? A CYS 41 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 41 A ZN 201 1_555 ? ? ? ? ? ? ? 2.339 ? ? metalc7 metalc ? ? A CYS 55 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 55 A ZN 401 1_555 ? ? ? ? ? ? ? 2.341 ? ? metalc8 metalc ? ? A CYS 58 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 58 A ZN 401 1_555 ? ? ? ? ? ? ? 2.354 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 CYS A 38 ? CYS A 38 . ? 1_555 ? 4 AC1 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 5 AC2 4 CYS A 33 ? CYS A 33 . ? 1_555 ? 6 AC2 4 HIS A 35 ? HIS A 35 . ? 1_555 ? 7 AC2 4 CYS A 55 ? CYS A 55 . ? 1_555 ? 8 AC2 4 CYS A 58 ? CYS A 58 . ? 1_555 ? # _database_PDB_matrix.entry_id 2ECJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2ECJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 TRP 45 45 45 TRP TRP A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 CYS 58 58 58 CYS CYS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 107.4 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 115.2 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 105.9 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 109.3 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 121.4 ? 6 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 97.8 ? 7 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 35 ? A HIS 35 ? 1_555 106.0 ? 8 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 110.3 ? 9 ND1 ? A HIS 35 ? A HIS 35 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 108.9 ? 10 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 103.3 ? 11 ND1 ? A HIS 35 ? A HIS 35 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 114.2 ? 12 SG ? A CYS 55 ? A CYS 55 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 113.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-14 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif 8 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_conn.pdbx_dist_value' 6 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 9 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 3 'Structure model' '_struct_ref_seq_dif.details' 19 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 20 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 21 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -129.70 -61.62 2 1 GLU A 10 ? ? -171.27 114.33 3 1 HIS A 35 ? ? -46.69 153.18 4 1 CYS A 41 ? ? -92.48 -69.71 5 1 ILE A 42 ? ? -37.10 -29.48 6 1 TRP A 46 ? ? -81.35 41.63 7 1 LEU A 49 ? ? -83.06 43.19 8 1 GLU A 50 ? ? -85.90 49.61 9 2 CYS A 18 ? ? -49.23 163.43 10 2 VAL A 20 ? ? -98.10 -67.67 11 2 HIS A 35 ? ? -48.99 158.15 12 2 CYS A 41 ? ? -92.58 -67.29 13 2 ILE A 42 ? ? -39.46 -36.00 14 3 ALA A 8 ? ? -97.94 39.73 15 3 CYS A 18 ? ? -45.67 167.18 16 3 LYS A 39 ? ? -37.52 -27.90 17 3 ILE A 42 ? ? -36.07 -30.81 18 3 ARG A 44 ? ? -39.25 -28.24 19 3 TRP A 46 ? ? -90.85 37.63 20 4 LEU A 9 ? ? -55.49 100.79 21 4 CYS A 41 ? ? -95.03 -64.39 22 4 TRP A 46 ? ? -80.55 42.85 23 4 GLU A 50 ? ? -77.47 47.85 24 4 ARG A 51 ? ? -57.24 -177.52 25 4 ASP A 52 ? ? 70.65 42.82 26 5 ALA A 8 ? ? -169.63 105.84 27 5 LEU A 12 ? ? -41.51 107.70 28 5 GLN A 13 ? ? -41.81 154.53 29 5 VAL A 20 ? ? -79.54 -70.05 30 5 VAL A 29 ? ? -69.43 96.46 31 5 GLU A 32 ? ? -83.43 37.18 32 5 CYS A 41 ? ? -94.72 -67.71 33 5 ASP A 48 ? ? -60.31 83.69 34 5 PHE A 53 ? ? -116.32 65.43 35 6 SER A 2 ? ? -174.36 132.34 36 6 SER A 5 ? ? -171.69 136.09 37 6 ALA A 8 ? ? -93.78 -62.26 38 6 LEU A 9 ? ? 35.94 41.89 39 6 GLU A 10 ? ? -53.07 95.51 40 6 LEU A 12 ? ? -69.95 98.49 41 6 HIS A 35 ? ? -33.54 146.85 42 6 ILE A 42 ? ? -36.12 -37.87 43 6 LEU A 49 ? ? -36.29 138.96 44 6 GLU A 50 ? ? -81.64 43.59 45 6 ARG A 51 ? ? -38.15 -38.23 46 6 PHE A 53 ? ? 32.41 54.79 47 6 VAL A 57 ? ? -115.81 -72.66 48 7 GLN A 13 ? ? -43.52 157.87 49 7 VAL A 20 ? ? -73.46 -72.85 50 7 CYS A 41 ? ? -95.04 -65.92 51 7 ILE A 42 ? ? -36.24 -31.45 52 7 TRP A 46 ? ? -89.17 46.31 53 7 GLU A 47 ? ? -62.80 77.45 54 8 SER A 5 ? ? -100.67 41.44 55 8 SER A 6 ? ? -59.85 171.60 56 8 ASN A 11 ? ? -172.67 107.25 57 8 VAL A 20 ? ? -73.12 -71.72 58 8 GLU A 32 ? ? -82.46 39.35 59 8 LYS A 39 ? ? -35.66 -30.81 60 8 ILE A 42 ? ? -36.04 -31.61 61 8 GLU A 47 ? ? -32.67 -38.80 62 8 LEU A 49 ? ? -40.20 161.54 63 8 GLU A 50 ? ? -79.18 44.84 64 8 ASP A 52 ? ? 35.26 45.82 65 8 PRO A 54 ? ? -69.75 -169.36 66 8 PRO A 56 ? ? -69.84 1.86 67 9 LEU A 12 ? ? -93.18 42.89 68 9 VAL A 14 ? ? -88.67 33.96 69 9 ALA A 16 ? ? -38.61 146.16 70 9 LEU A 22 ? ? 34.01 34.65 71 9 HIS A 35 ? ? -34.65 142.56 72 9 CYS A 41 ? ? -94.78 -68.72 73 9 ILE A 42 ? ? -37.40 -39.92 74 9 GLU A 47 ? ? -35.47 -36.66 75 9 ASP A 48 ? ? -90.61 56.86 76 9 ASP A 52 ? ? -49.24 100.93 77 9 CYS A 55 ? ? -39.41 135.07 78 10 LEU A 12 ? ? -83.43 44.28 79 10 ALA A 16 ? ? -34.54 144.22 80 10 LEU A 22 ? ? 34.38 51.60 81 10 PRO A 28 ? ? -69.79 -172.96 82 10 ILE A 31 ? ? -51.74 -174.10 83 10 GLU A 32 ? ? -80.72 40.28 84 10 ILE A 42 ? ? -39.10 -32.28 85 10 TRP A 46 ? ? -93.03 31.82 86 10 ARG A 51 ? ? -36.05 144.71 87 11 SER A 6 ? ? -47.30 103.33 88 11 ALA A 8 ? ? -45.44 166.79 89 11 VAL A 20 ? ? -81.88 -74.31 90 11 ILE A 31 ? ? -69.83 -174.78 91 11 GLU A 32 ? ? -81.38 40.71 92 11 CYS A 33 ? ? -133.89 -48.72 93 11 CYS A 41 ? ? -93.47 -72.47 94 11 ILE A 42 ? ? -36.17 -35.41 95 11 LEU A 49 ? ? -81.92 40.07 96 11 CYS A 55 ? ? -169.17 119.17 97 12 SER A 17 ? ? -173.07 147.40 98 12 CYS A 18 ? ? -48.40 167.32 99 12 ILE A 31 ? ? -61.91 -177.47 100 12 GLU A 32 ? ? -81.99 39.10 101 12 HIS A 35 ? ? -57.71 174.77 102 12 CYS A 41 ? ? -95.87 -61.04 103 12 GLU A 47 ? ? -33.64 119.13 104 12 LEU A 49 ? ? -43.19 95.75 105 12 PHE A 53 ? ? -107.82 79.21 106 12 PRO A 54 ? ? -69.84 92.78 107 12 CYS A 55 ? ? -161.05 110.31 108 13 SER A 5 ? ? -57.64 97.72 109 13 LEU A 12 ? ? -106.89 40.26 110 13 CYS A 18 ? ? -42.74 165.41 111 13 LEU A 22 ? ? 34.03 41.08 112 13 VAL A 29 ? ? -67.93 91.34 113 13 ILE A 31 ? ? -56.69 -175.14 114 13 GLU A 32 ? ? -83.48 36.35 115 13 ILE A 42 ? ? -36.86 -35.69 116 13 TRP A 46 ? ? -105.59 40.10 117 13 PHE A 53 ? ? -35.01 152.51 118 14 SER A 6 ? ? -108.05 42.10 119 14 VAL A 20 ? ? -77.59 -73.03 120 14 HIS A 35 ? ? -32.10 135.65 121 14 CYS A 41 ? ? -95.47 -64.38 122 14 ILE A 42 ? ? -38.64 -26.29 123 14 TRP A 46 ? ? -78.62 45.42 124 14 GLU A 50 ? ? -126.53 -59.33 125 14 ARG A 51 ? ? -132.36 -45.76 126 14 PHE A 53 ? ? -115.90 62.71 127 15 CYS A 18 ? ? -47.65 166.57 128 15 VAL A 20 ? ? -77.00 -70.79 129 15 PRO A 28 ? ? -69.76 -177.82 130 15 HIS A 35 ? ? -39.69 142.83 131 15 TRP A 46 ? ? -107.85 42.05 132 15 LEU A 49 ? ? -48.02 177.58 133 15 GLU A 50 ? ? -117.18 54.35 134 15 PHE A 53 ? ? -112.54 65.57 135 15 PRO A 54 ? ? -69.76 98.29 136 16 SER A 2 ? ? -82.70 48.70 137 16 ALA A 8 ? ? -125.95 -57.87 138 16 GLU A 10 ? ? -58.51 171.37 139 16 LEU A 22 ? ? 33.98 40.38 140 16 ILE A 31 ? ? -50.69 -176.37 141 16 GLU A 32 ? ? -79.67 41.57 142 16 HIS A 35 ? ? -53.23 179.18 143 16 CYS A 41 ? ? -90.42 -70.03 144 16 GLU A 47 ? ? -29.38 -46.92 145 16 LEU A 49 ? ? -75.71 48.61 146 16 CYS A 55 ? ? -175.05 136.85 147 17 GLN A 13 ? ? -101.16 41.37 148 17 CYS A 18 ? ? -45.49 167.31 149 17 GLU A 27 ? ? 75.02 54.93 150 17 CYS A 41 ? ? -93.26 -69.15 151 17 ILE A 42 ? ? -36.02 -39.78 152 17 GLU A 50 ? ? -122.15 -62.83 153 18 LEU A 12 ? ? -92.10 33.86 154 18 VAL A 29 ? ? -66.35 85.81 155 18 ILE A 31 ? ? -66.33 -176.05 156 18 GLU A 32 ? ? -81.38 39.82 157 18 CYS A 41 ? ? -93.67 -65.82 158 18 TRP A 46 ? ? -82.89 38.00 159 18 GLU A 50 ? ? -127.17 -57.51 160 18 PHE A 53 ? ? 35.51 53.80 161 19 SER A 2 ? ? -69.51 86.81 162 19 SER A 6 ? ? -66.61 87.83 163 19 VAL A 20 ? ? -75.48 -71.76 164 19 HIS A 35 ? ? -45.23 163.85 165 19 ILE A 42 ? ? -36.10 -34.20 166 19 TRP A 46 ? ? -94.87 44.95 167 19 LEU A 49 ? ? -84.36 39.00 168 19 ASP A 52 ? ? -132.95 -45.12 169 19 PRO A 54 ? ? -69.78 -178.88 170 19 CYS A 55 ? ? -33.48 122.05 171 20 LEU A 9 ? ? -82.52 41.83 172 20 GLU A 10 ? ? -36.69 133.57 173 20 VAL A 20 ? ? -132.28 -63.42 174 20 CYS A 41 ? ? -95.32 -66.31 175 20 ILE A 42 ? ? -36.96 -31.40 176 20 TRP A 46 ? ? -85.57 38.16 177 20 LEU A 49 ? ? -47.44 175.45 178 20 GLU A 50 ? ? -87.68 45.82 179 20 PHE A 53 ? ? -118.90 72.96 180 20 CYS A 55 ? ? -38.30 114.76 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #