data_2EE2 # _entry.id 2EE2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EE2 pdb_00002ee2 10.2210/pdb2ee2/pdb RCSB RCSB026549 ? ? WWPDB D_1000026549 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk003001294.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EE2 _pdbx_database_status.recvd_initial_deposition_date 2007-02-15 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sato, M.' 1 'Tochio, N.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structures of the fn3 domain of human contactin 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sato, M.' 1 ? primary 'Tochio, N.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Contactin-1 _entity.formula_weight 12640.807 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Fibronectin type III domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Neural cell surface protein F3, Glycoprotein gp135' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKIVESYQIRYWAAHDKEEAANRVQVTSQEYSARLEN LLPDTQYFIEVGACNSAGCGPPSDMIEAFTKKASGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKIVESYQIRYWAAHDKEEAANRVQVTSQEYSARLEN LLPDTQYFIEVGACNSAGCGPPSDMIEAFTKKASGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk003001294.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 VAL n 1 9 ALA n 1 10 VAL n 1 11 ILE n 1 12 ASN n 1 13 SER n 1 14 ALA n 1 15 GLN n 1 16 ASP n 1 17 ALA n 1 18 PRO n 1 19 SER n 1 20 GLU n 1 21 ALA n 1 22 PRO n 1 23 THR n 1 24 GLU n 1 25 VAL n 1 26 GLY n 1 27 VAL n 1 28 LYS n 1 29 VAL n 1 30 LEU n 1 31 SER n 1 32 SER n 1 33 SER n 1 34 GLU n 1 35 ILE n 1 36 SER n 1 37 VAL n 1 38 HIS n 1 39 TRP n 1 40 GLU n 1 41 HIS n 1 42 VAL n 1 43 LEU n 1 44 GLU n 1 45 LYS n 1 46 ILE n 1 47 VAL n 1 48 GLU n 1 49 SER n 1 50 TYR n 1 51 GLN n 1 52 ILE n 1 53 ARG n 1 54 TYR n 1 55 TRP n 1 56 ALA n 1 57 ALA n 1 58 HIS n 1 59 ASP n 1 60 LYS n 1 61 GLU n 1 62 GLU n 1 63 ALA n 1 64 ALA n 1 65 ASN n 1 66 ARG n 1 67 VAL n 1 68 GLN n 1 69 VAL n 1 70 THR n 1 71 SER n 1 72 GLN n 1 73 GLU n 1 74 TYR n 1 75 SER n 1 76 ALA n 1 77 ARG n 1 78 LEU n 1 79 GLU n 1 80 ASN n 1 81 LEU n 1 82 LEU n 1 83 PRO n 1 84 ASP n 1 85 THR n 1 86 GLN n 1 87 TYR n 1 88 PHE n 1 89 ILE n 1 90 GLU n 1 91 VAL n 1 92 GLY n 1 93 ALA n 1 94 CYS n 1 95 ASN n 1 96 SER n 1 97 ALA n 1 98 GLY n 1 99 CYS n 1 100 GLY n 1 101 PRO n 1 102 PRO n 1 103 SER n 1 104 ASP n 1 105 MET n 1 106 ILE n 1 107 GLU n 1 108 ALA n 1 109 PHE n 1 110 THR n 1 111 LYS n 1 112 LYS n 1 113 ALA n 1 114 SER n 1 115 GLY n 1 116 PRO n 1 117 SER n 1 118 SER n 1 119 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene CNTN1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050711-22 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CNTN1_HUMAN _struct_ref.pdbx_db_accession Q12860 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKIVESYQIRYWAAHDKEEAANRVQVTSQEYSARLENLLPDTQY FIEVGACNSAGCGPPSDMIEAFTKKA ; _struct_ref.pdbx_align_begin 798 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EE2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 113 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q12860 _struct_ref_seq.db_align_beg 798 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 903 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 113 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EE2 GLY A 1 ? UNP Q12860 ? ? 'expression tag' 1 1 1 2EE2 SER A 2 ? UNP Q12860 ? ? 'expression tag' 2 2 1 2EE2 SER A 3 ? UNP Q12860 ? ? 'expression tag' 3 3 1 2EE2 GLY A 4 ? UNP Q12860 ? ? 'expression tag' 4 4 1 2EE2 SER A 5 ? UNP Q12860 ? ? 'expression tag' 5 5 1 2EE2 SER A 6 ? UNP Q12860 ? ? 'expression tag' 6 6 1 2EE2 GLY A 7 ? UNP Q12860 ? ? 'expression tag' 7 7 1 2EE2 SER A 114 ? UNP Q12860 ? ? 'expression tag' 114 8 1 2EE2 GLY A 115 ? UNP Q12860 ? ? 'expression tag' 115 9 1 2EE2 PRO A 116 ? UNP Q12860 ? ? 'expression tag' 116 10 1 2EE2 SER A 117 ? UNP Q12860 ? ? 'expression tag' 117 11 1 2EE2 SER A 118 ? UNP Q12860 ? ? 'expression tag' 118 12 1 2EE2 GLY A 119 ? UNP Q12860 ? ? 'expression tag' 119 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM fn3 domain U-15N, 13C; 20mM d-Tris HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2EE2 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2EE2 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EE2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 2.0.17 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2EE2 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EE2 _struct.title 'Solution structures of the fn3 domain of human contactin 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EE2 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;Neural cell surface protein F3, Glycoprotein gp135, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 60 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 64 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 60 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 64 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 26 ? SER A 31 ? GLY A 26 SER A 31 A 2 GLU A 34 ? HIS A 38 ? GLU A 34 HIS A 38 A 3 SER A 75 ? LEU A 78 ? SER A 75 LEU A 78 B 1 ASN A 65 ? THR A 70 ? ASN A 65 THR A 70 B 2 SER A 49 ? ALA A 56 ? SER A 49 ALA A 56 B 3 GLN A 86 ? CYS A 94 ? GLN A 86 CYS A 94 B 4 ILE A 106 ? PHE A 109 ? ILE A 106 PHE A 109 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 28 ? N LYS A 28 O SER A 36 ? O SER A 36 A 2 3 N ILE A 35 ? N ILE A 35 O LEU A 78 ? O LEU A 78 B 1 2 O VAL A 67 ? O VAL A 67 N ILE A 52 ? N ILE A 52 B 2 3 N GLN A 51 ? N GLN A 51 O GLY A 92 ? O GLY A 92 B 3 4 N TYR A 87 ? N TYR A 87 O ALA A 108 ? O ALA A 108 # _database_PDB_matrix.entry_id 2EE2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2EE2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 TRP 55 55 55 TRP TRP A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 CYS 94 94 94 CYS CYS A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 CYS 99 99 99 CYS CYS A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 GLY 119 119 119 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 8 ? ? -33.98 123.25 2 1 ASN A 65 ? ? -58.40 174.37 3 1 ALA A 97 ? ? -83.01 -73.60 4 1 SER A 117 ? ? -36.97 110.58 5 2 SER A 5 ? ? -39.11 146.80 6 2 VAL A 8 ? ? -39.19 122.64 7 2 ALA A 9 ? ? -171.25 110.92 8 2 SER A 49 ? ? -171.05 -179.74 9 2 ASP A 84 ? ? 35.34 53.54 10 2 CYS A 94 ? ? -172.20 139.47 11 3 ASP A 16 ? ? -171.70 -175.36 12 3 ASP A 59 ? ? -57.84 173.36 13 3 ASP A 84 ? ? 38.97 50.48 14 3 CYS A 94 ? ? -173.07 145.95 15 3 ALA A 97 ? ? -82.74 -71.24 16 3 PRO A 116 ? ? -69.81 89.08 17 4 ASN A 12 ? ? -39.48 133.57 18 4 PRO A 22 ? ? -69.80 97.63 19 4 GLU A 73 ? ? -63.92 99.24 20 4 ASP A 84 ? ? 39.82 48.93 21 4 ALA A 97 ? ? -68.31 -70.20 22 4 THR A 110 ? ? -57.33 173.99 23 4 SER A 114 ? ? -49.55 177.40 24 4 PRO A 116 ? ? -69.77 96.99 25 5 ASP A 59 ? ? -52.89 173.19 26 5 ALA A 97 ? ? -68.47 -71.36 27 5 ALA A 113 ? ? -35.37 140.81 28 6 ALA A 9 ? ? -172.97 116.02 29 6 PRO A 22 ? ? -69.76 95.04 30 6 THR A 70 ? ? -34.29 146.15 31 6 ALA A 97 ? ? -59.06 -72.03 32 7 SER A 6 ? ? 36.70 44.82 33 7 ALA A 9 ? ? -170.23 139.49 34 7 TYR A 54 ? ? -175.20 135.29 35 7 ASP A 84 ? ? 35.76 51.80 36 7 ALA A 97 ? ? -75.37 -74.41 37 7 ALA A 113 ? ? -59.76 93.47 38 8 SER A 6 ? ? -105.35 42.01 39 8 ALA A 57 ? ? -39.51 -39.69 40 8 MET A 105 ? ? -58.49 103.61 41 9 ALA A 9 ? ? -163.91 117.91 42 9 ASP A 84 ? ? 34.53 48.62 43 9 ALA A 97 ? ? -62.70 -72.95 44 10 ILE A 11 ? ? -85.91 43.90 45 10 ASN A 80 ? ? 71.57 42.46 46 10 ALA A 97 ? ? -76.43 -73.65 47 10 SER A 103 ? ? -56.71 -178.42 48 10 ALA A 113 ? ? 34.18 36.47 49 11 ASP A 16 ? ? -171.08 -179.41 50 11 ALA A 97 ? ? -68.67 -74.69 51 11 ALA A 113 ? ? -61.53 88.01 52 12 ALA A 9 ? ? -174.89 109.39 53 12 PRO A 22 ? ? -69.80 99.63 54 13 PRO A 22 ? ? -69.76 97.42 55 13 THR A 70 ? ? -36.16 137.08 56 13 CYS A 94 ? ? -173.47 141.83 57 13 ALA A 97 ? ? -55.71 -74.82 58 13 PRO A 116 ? ? -69.73 94.64 59 14 ILE A 11 ? ? -38.42 151.92 60 14 ASN A 80 ? ? 70.93 42.94 61 14 ASP A 84 ? ? 36.85 49.70 62 14 ALA A 97 ? ? -71.51 -74.97 63 14 ALA A 113 ? ? -38.56 122.72 64 14 SER A 114 ? ? -48.41 159.07 65 14 PRO A 116 ? ? -69.72 95.60 66 15 ALA A 9 ? ? -160.20 111.82 67 15 GLN A 15 ? ? -131.42 -38.64 68 15 PRO A 22 ? ? -69.74 99.56 69 15 GLU A 73 ? ? -57.51 92.47 70 15 ASP A 84 ? ? 38.98 53.49 71 15 ALA A 97 ? ? -51.01 -70.08 72 15 ALA A 113 ? ? -64.69 87.01 73 16 ALA A 9 ? ? -173.66 105.95 74 16 ILE A 11 ? ? -34.33 122.60 75 16 ASN A 12 ? ? -100.24 40.89 76 16 CYS A 94 ? ? -170.57 144.35 77 16 ALA A 97 ? ? -74.04 -75.03 78 16 ALA A 113 ? ? 34.02 36.42 79 17 SER A 2 ? ? -57.22 177.50 80 17 TRP A 55 ? ? -172.16 146.97 81 17 ASP A 59 ? ? -54.42 170.91 82 17 ASN A 80 ? ? 71.28 51.03 83 17 ALA A 97 ? ? -92.34 -71.34 84 18 SER A 6 ? ? -63.09 91.36 85 18 ASP A 16 ? ? -173.65 -175.64 86 18 PRO A 22 ? ? -69.74 98.00 87 18 ASN A 80 ? ? 74.96 48.11 88 18 ALA A 97 ? ? -79.51 -72.08 89 18 THR A 110 ? ? -66.40 -177.29 90 18 SER A 117 ? ? -37.94 104.11 91 19 GLU A 24 ? ? 35.83 51.27 92 19 ASP A 59 ? ? -51.57 172.70 93 19 ASP A 84 ? ? 37.60 47.04 94 19 ALA A 97 ? ? -65.74 -74.60 95 19 ALA A 113 ? ? -69.87 97.35 96 20 ALA A 9 ? ? -45.19 98.19 97 20 ASP A 59 ? ? -51.37 174.90 98 20 ALA A 97 ? ? -55.19 -74.43 99 20 THR A 110 ? ? -57.19 -175.22 #