data_2EED # _entry.id 2EED # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EED pdb_00002eed 10.2210/pdb2eed/pdb RCSB RCSB026560 ? ? WWPDB D_1000026560 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk003002600.12 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EED _pdbx_database_status.recvd_initial_deposition_date 2007-02-15 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tomizawa, T.' 1 'Koshiba, S.' 2 'Watanabe, S.' 3 'Harada, T.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the 24th filamin domain from human Filamin-B' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tomizawa, T.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Watanabe, S.' 3 ? primary 'Harada, T.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Filamin-B _entity.formula_weight 10539.823 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'filamin domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;FLN-B, Beta-filamin, Actin-binding-like protein, Thyroid autoantigen, Truncated actin-binding protein, Truncated ABP, ABP-280 homolog, ABP-278, Filamin 3, Filamin homolog 1, Fh1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGSSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDY VLAVKWGEEHIPGSPFHVTVP ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGSSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDY VLAVKWGEEHIPGSPFHVTVP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk003002600.12 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 SER n 1 10 ASP n 1 11 ALA n 1 12 SER n 1 13 LYS n 1 14 VAL n 1 15 THR n 1 16 SER n 1 17 LYS n 1 18 GLY n 1 19 ALA n 1 20 GLY n 1 21 LEU n 1 22 SER n 1 23 LYS n 1 24 ALA n 1 25 PHE n 1 26 VAL n 1 27 GLY n 1 28 GLN n 1 29 LYS n 1 30 SER n 1 31 SER n 1 32 PHE n 1 33 LEU n 1 34 VAL n 1 35 ASP n 1 36 CYS n 1 37 SER n 1 38 LYS n 1 39 ALA n 1 40 GLY n 1 41 SER n 1 42 ASN n 1 43 MET n 1 44 LEU n 1 45 LEU n 1 46 ILE n 1 47 GLY n 1 48 VAL n 1 49 HIS n 1 50 GLY n 1 51 PRO n 1 52 THR n 1 53 THR n 1 54 PRO n 1 55 CYS n 1 56 GLU n 1 57 GLU n 1 58 VAL n 1 59 SER n 1 60 MET n 1 61 LYS n 1 62 HIS n 1 63 VAL n 1 64 GLY n 1 65 ASN n 1 66 GLN n 1 67 GLN n 1 68 TYR n 1 69 ASN n 1 70 VAL n 1 71 THR n 1 72 TYR n 1 73 VAL n 1 74 VAL n 1 75 LYS n 1 76 GLU n 1 77 ARG n 1 78 GLY n 1 79 ASP n 1 80 TYR n 1 81 VAL n 1 82 LEU n 1 83 ALA n 1 84 VAL n 1 85 LYS n 1 86 TRP n 1 87 GLY n 1 88 GLU n 1 89 GLU n 1 90 HIS n 1 91 ILE n 1 92 PRO n 1 93 GLY n 1 94 SER n 1 95 PRO n 1 96 PHE n 1 97 HIS n 1 98 VAL n 1 99 THR n 1 100 VAL n 1 101 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'FLNB, FLN1L, FLN3, TABP, TAP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060613-01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FLNB_HUMAN _struct_ref.pdbx_db_accession O75369 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWG EEHIPGSPFHVTVP ; _struct_ref.pdbx_align_begin 2509 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EED _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 101 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O75369 _struct_ref_seq.db_align_beg 2509 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 2602 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 101 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EED GLY A 1 ? UNP O75369 ? ? 'expression tag' 1 1 1 2EED SER A 2 ? UNP O75369 ? ? 'expression tag' 2 2 1 2EED SER A 3 ? UNP O75369 ? ? 'expression tag' 3 3 1 2EED GLY A 4 ? UNP O75369 ? ? 'expression tag' 4 4 1 2EED SER A 5 ? UNP O75369 ? ? 'expression tag' 5 5 1 2EED SER A 6 ? UNP O75369 ? ? 'expression tag' 6 6 1 2EED GLY A 7 ? UNP O75369 ? ? 'expression tag' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.11mM filamin domain U-15N,13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE II' _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2EED _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2EED _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EED _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection TopSpin 1.3 Bruker 1 processing NMRPipe 20060524 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9823 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2EED _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EED _struct.title 'Solution structure of the 24th filamin domain from human Filamin-B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EED _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text ;beta-sandwich, immunoglobulin-like fold, filamin, self association, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 19 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 23 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 19 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 23 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 1 -0.08 2 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 2 -0.07 3 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 3 -0.05 4 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 4 -0.02 5 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 5 -0.09 6 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 6 -0.04 7 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 7 0.05 8 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 8 0.08 9 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 9 -0.11 10 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 10 0.02 11 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 11 -0.09 12 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 12 -0.08 13 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 13 -0.05 14 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 14 0.01 15 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 15 -0.01 16 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 16 0.03 17 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 17 -0.02 18 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 18 -0.02 19 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 19 -0.01 20 SER 94 A . ? SER 94 A PRO 95 A ? PRO 95 A 20 -0.04 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 15 ? GLY A 18 ? THR A 15 GLY A 18 A 2 SER A 30 ? ASP A 35 ? SER A 30 ASP A 35 A 3 GLN A 67 ? VAL A 73 ? GLN A 67 VAL A 73 A 4 GLU A 57 ? GLY A 64 ? GLU A 57 GLY A 64 B 1 LEU A 44 ? ILE A 46 ? LEU A 44 ILE A 46 B 2 VAL A 84 ? TRP A 86 ? VAL A 84 TRP A 86 C 1 GLY A 78 ? LEU A 82 ? GLY A 78 LEU A 82 C 2 PHE A 96 ? VAL A 100 ? PHE A 96 VAL A 100 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 15 ? N THR A 15 O ASP A 35 ? O ASP A 35 A 2 3 N SER A 30 ? N SER A 30 O TYR A 72 ? O TYR A 72 A 3 4 O THR A 71 ? O THR A 71 N SER A 59 ? N SER A 59 B 1 2 N LEU A 45 ? N LEU A 45 O LYS A 85 ? O LYS A 85 C 1 2 N TYR A 80 ? N TYR A 80 O VAL A 98 ? O VAL A 98 # _database_PDB_matrix.entry_id 2EED _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2EED _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 PRO 101 101 101 PRO PRO A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? 34.84 39.58 2 1 SER A 41 ? ? -91.28 37.16 3 1 VAL A 48 ? ? -44.81 108.14 4 1 ILE A 91 ? ? -48.35 151.23 5 1 PRO A 92 ? ? -69.80 99.19 6 2 SER A 5 ? ? -36.53 127.71 7 2 GLN A 28 ? ? -51.86 176.83 8 2 SER A 41 ? ? -172.09 109.22 9 2 VAL A 48 ? ? -45.65 96.24 10 2 ILE A 91 ? ? -45.97 151.25 11 2 PRO A 92 ? ? -69.79 93.20 12 3 GLN A 28 ? ? -56.41 -179.80 13 3 THR A 52 ? ? -124.56 -53.01 14 3 HIS A 62 ? ? -100.73 79.13 15 3 PRO A 92 ? ? -69.75 94.80 16 4 SER A 5 ? ? -105.76 -62.43 17 4 SER A 6 ? ? -165.51 115.15 18 4 SER A 41 ? ? -94.42 39.63 19 4 THR A 52 ? ? -123.31 -53.85 20 4 ILE A 91 ? ? -45.63 150.50 21 5 ALA A 19 ? ? -125.31 -50.66 22 5 THR A 52 ? ? -132.67 -51.66 23 5 HIS A 62 ? ? -105.71 78.85 24 5 ILE A 91 ? ? -46.38 151.28 25 6 SER A 8 ? ? 39.53 48.37 26 6 GLN A 28 ? ? -54.31 -177.88 27 6 ALA A 39 ? ? -99.05 -63.18 28 6 SER A 41 ? ? -89.58 38.29 29 6 THR A 52 ? ? -131.64 -57.44 30 6 PRO A 54 ? ? -69.72 -167.07 31 6 ILE A 91 ? ? -45.78 150.97 32 6 PRO A 92 ? ? -69.76 98.82 33 7 SER A 8 ? ? -37.30 97.75 34 7 GLN A 28 ? ? -52.68 177.48 35 7 SER A 41 ? ? -172.11 107.45 36 7 THR A 52 ? ? -132.22 -56.46 37 7 ILE A 91 ? ? -47.84 150.58 38 7 PRO A 92 ? ? -69.77 94.00 39 8 THR A 52 ? ? -130.42 -39.29 40 8 THR A 53 ? ? -160.21 119.17 41 8 PRO A 92 ? ? -69.77 95.40 42 9 ALA A 39 ? ? -62.94 -73.28 43 9 VAL A 48 ? ? -45.65 104.94 44 9 PRO A 92 ? ? -69.78 94.45 45 10 SER A 8 ? ? -45.32 159.65 46 10 ALA A 39 ? ? -96.19 -62.87 47 10 SER A 41 ? ? -88.03 35.45 48 10 THR A 52 ? ? -132.20 -66.02 49 10 PRO A 54 ? ? -69.76 -172.02 50 10 PRO A 92 ? ? -69.72 92.96 51 11 THR A 52 ? ? -120.35 -58.51 52 11 HIS A 62 ? ? -101.53 65.41 53 11 VAL A 63 ? ? -36.29 -31.15 54 12 THR A 52 ? ? -134.58 -59.67 55 12 PRO A 54 ? ? -69.79 -177.96 56 12 PRO A 92 ? ? -69.77 93.28 57 13 LYS A 29 ? ? -60.72 99.34 58 13 ALA A 39 ? ? -69.28 -73.46 59 13 HIS A 62 ? ? -101.73 79.20 60 13 ILE A 91 ? ? -37.06 151.41 61 13 PRO A 92 ? ? -69.73 97.69 62 14 SER A 9 ? ? -171.00 112.41 63 14 GLN A 28 ? ? -57.83 172.31 64 14 LYS A 38 ? ? -99.55 32.89 65 14 SER A 41 ? ? -96.87 40.70 66 14 THR A 52 ? ? -127.00 -55.17 67 14 ILE A 91 ? ? -46.76 150.83 68 14 PRO A 92 ? ? -69.75 93.29 69 15 SER A 3 ? ? -124.72 -51.88 70 15 PRO A 92 ? ? -69.77 99.52 71 16 THR A 52 ? ? -133.45 -64.24 72 16 VAL A 63 ? ? -38.91 -32.54 73 16 ILE A 91 ? ? -43.02 150.87 74 17 SER A 9 ? ? -39.04 136.45 75 17 VAL A 26 ? ? -34.79 129.82 76 17 SER A 41 ? ? -94.88 34.64 77 17 THR A 52 ? ? -128.94 -61.04 78 17 PRO A 54 ? ? -69.74 -173.89 79 17 PRO A 92 ? ? -69.70 98.42 80 18 ALA A 39 ? ? -60.72 -70.72 81 18 SER A 41 ? ? -169.58 105.51 82 18 VAL A 48 ? ? -39.35 105.31 83 18 THR A 52 ? ? -124.27 -57.40 84 18 HIS A 62 ? ? -110.39 68.09 85 18 VAL A 63 ? ? -37.53 -32.38 86 18 ILE A 91 ? ? -44.19 151.50 87 18 PRO A 92 ? ? -69.78 99.16 88 19 ALA A 39 ? ? -97.69 -62.36 89 19 SER A 41 ? ? -107.37 69.65 90 19 VAL A 48 ? ? -38.05 95.24 91 19 ILE A 91 ? ? -42.96 151.68 92 20 SER A 3 ? ? -58.31 95.89 93 20 SER A 41 ? ? -165.29 114.04 94 20 VAL A 63 ? ? -47.88 -19.94 95 20 ILE A 91 ? ? -44.35 150.04 96 20 PRO A 92 ? ? -69.78 92.91 #