data_2EEL # _entry.id 2EEL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EEL pdb_00002eel 10.2210/pdb2eel/pdb RCSB RCSB026568 ? ? WWPDB D_1000026568 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002022361.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EEL _pdbx_database_status.recvd_initial_deposition_date 2007-02-15 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Nagashima, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the CIDE-N domain of human cell death activator CIDE-A' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Nagashima, T.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cell death activator CIDE-A' _entity.formula_weight 9733.857 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'CIDE-N domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cell death-inducing DFFA-like effector A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKG QKWMPSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKG QKWMPSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002022361.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 ALA n 1 10 ARG n 1 11 PRO n 1 12 PHE n 1 13 ARG n 1 14 VAL n 1 15 SER n 1 16 ASN n 1 17 HIS n 1 18 ASP n 1 19 ARG n 1 20 SER n 1 21 SER n 1 22 ARG n 1 23 ARG n 1 24 GLY n 1 25 VAL n 1 26 MET n 1 27 ALA n 1 28 SER n 1 29 SER n 1 30 LEU n 1 31 GLN n 1 32 GLU n 1 33 LEU n 1 34 ILE n 1 35 SER n 1 36 LYS n 1 37 THR n 1 38 LEU n 1 39 ASP n 1 40 ALA n 1 41 LEU n 1 42 VAL n 1 43 ILE n 1 44 ALA n 1 45 THR n 1 46 GLY n 1 47 LEU n 1 48 VAL n 1 49 THR n 1 50 LEU n 1 51 VAL n 1 52 LEU n 1 53 GLU n 1 54 GLU n 1 55 ASP n 1 56 GLY n 1 57 THR n 1 58 VAL n 1 59 VAL n 1 60 ASP n 1 61 THR n 1 62 GLU n 1 63 GLU n 1 64 PHE n 1 65 PHE n 1 66 GLN n 1 67 THR n 1 68 LEU n 1 69 GLY n 1 70 ASP n 1 71 ASN n 1 72 THR n 1 73 HIS n 1 74 PHE n 1 75 MET n 1 76 ILE n 1 77 LEU n 1 78 GLU n 1 79 LYS n 1 80 GLY n 1 81 GLN n 1 82 LYS n 1 83 TRP n 1 84 MET n 1 85 PRO n 1 86 SER n 1 87 GLY n 1 88 PRO n 1 89 SER n 1 90 SER n 1 91 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene CIDEA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050613-03 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CIDEA_HUMAN _struct_ref.pdbx_db_accession O60543 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMP _struct_ref.pdbx_align_begin 33 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EEL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O60543 _struct_ref_seq.db_align_beg 33 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 110 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 85 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EEL GLY A 1 ? UNP O60543 ? ? 'expression tag' 1 1 1 2EEL SER A 2 ? UNP O60543 ? ? 'expression tag' 2 2 1 2EEL SER A 3 ? UNP O60543 ? ? 'expression tag' 3 3 1 2EEL GLY A 4 ? UNP O60543 ? ? 'expression tag' 4 4 1 2EEL SER A 5 ? UNP O60543 ? ? 'expression tag' 5 5 1 2EEL SER A 6 ? UNP O60543 ? ? 'expression tag' 6 6 1 2EEL GLY A 7 ? UNP O60543 ? ? 'expression tag' 7 7 1 2EEL SER A 86 ? UNP O60543 ? ? 'expression tag' 86 8 1 2EEL GLY A 87 ? UNP O60543 ? ? 'expression tag' 87 9 1 2EEL PRO A 88 ? UNP O60543 ? ? 'expression tag' 88 10 1 2EEL SER A 89 ? UNP O60543 ? ? 'expression tag' 89 11 1 2EEL SER A 90 ? UNP O60543 ? ? 'expression tag' 90 12 1 2EEL GLY A 91 ? UNP O60543 ? ? 'expression tag' 91 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.10mM 13C,15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2EEL _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2EEL _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EEL _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9816 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2EEL _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EEL _struct.title 'Solution structure of the CIDE-N domain of human cell death activator CIDE-A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EEL _struct_keywords.pdbx_keywords APOPTOSIS _struct_keywords.text ;CIDE-N domain, Cell death activator CIDE-A, Cell death-inducing DFFA-like effector A, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, APOPTOSIS ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 29 ? LEU A 41 ? SER A 29 LEU A 41 1 ? 13 HELX_P HELX_P2 2 THR A 61 ? GLN A 66 ? THR A 61 GLN A 66 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 23 ? ALA A 27 ? ARG A 23 ALA A 27 A 2 ARG A 10 ? SER A 15 ? ARG A 10 SER A 15 A 3 THR A 72 ? GLU A 78 ? THR A 72 GLU A 78 A 4 VAL A 48 ? LEU A 52 ? VAL A 48 LEU A 52 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 23 ? O ARG A 23 N VAL A 14 ? N VAL A 14 A 2 3 N ARG A 13 ? N ARG A 13 O THR A 72 ? O THR A 72 A 3 4 O MET A 75 ? O MET A 75 N VAL A 51 ? N VAL A 51 # _database_PDB_matrix.entry_id 2EEL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2EEL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 MET 75 75 75 MET MET A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 TRP 83 83 83 TRP TRP A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 GLY 91 91 91 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? -68.84 87.13 2 1 ARG A 19 ? ? 35.78 45.90 3 1 LEU A 47 ? ? -57.56 99.54 4 1 LYS A 79 ? ? -60.84 80.83 5 1 PRO A 85 ? ? -69.78 -179.69 6 2 ARG A 19 ? ? 36.22 47.31 7 2 THR A 37 ? ? -39.26 -38.76 8 2 LEU A 47 ? ? -63.42 95.64 9 2 LYS A 79 ? ? -61.79 87.80 10 2 PRO A 85 ? ? -69.74 -178.09 11 3 ARG A 19 ? ? 35.12 34.29 12 3 LYS A 79 ? ? -62.21 81.74 13 3 PRO A 85 ? ? -69.78 -178.03 14 3 PRO A 88 ? ? -69.74 99.63 15 4 SER A 5 ? ? -38.69 103.65 16 4 LEU A 33 ? ? -58.74 -71.63 17 4 LYS A 79 ? ? -64.85 79.76 18 4 PRO A 85 ? ? -69.74 -164.78 19 5 SER A 5 ? ? -121.60 -73.17 20 5 ARG A 19 ? ? 36.82 42.27 21 5 LEU A 33 ? ? -57.29 -70.24 22 5 LEU A 47 ? ? -45.77 96.96 23 5 LYS A 79 ? ? -60.77 82.36 24 5 PRO A 85 ? ? -69.83 -177.10 25 5 PRO A 88 ? ? -69.70 91.31 26 6 ARG A 19 ? ? 36.61 44.39 27 6 LEU A 47 ? ? -55.01 103.56 28 6 VAL A 58 ? ? -57.14 109.64 29 6 LYS A 79 ? ? -63.37 84.69 30 6 PRO A 85 ? ? -69.77 -173.73 31 6 PRO A 88 ? ? -69.85 87.45 32 7 VAL A 42 ? ? 35.87 39.82 33 7 LEU A 47 ? ? -55.71 99.80 34 7 ASP A 70 ? ? -38.43 155.44 35 7 LYS A 79 ? ? -61.29 78.13 36 7 PRO A 85 ? ? -69.71 -178.65 37 8 ARG A 19 ? ? 39.95 41.90 38 8 LEU A 33 ? ? -62.81 -70.81 39 8 VAL A 42 ? ? 37.77 49.02 40 8 ASP A 70 ? ? -37.60 154.74 41 8 LYS A 79 ? ? -55.96 84.40 42 8 PRO A 85 ? ? -69.73 -179.32 43 8 SER A 89 ? ? -173.68 135.37 44 9 VAL A 42 ? ? 35.97 44.08 45 9 LEU A 47 ? ? -59.27 97.30 46 9 LYS A 79 ? ? -63.94 89.37 47 9 PRO A 85 ? ? -69.76 -169.24 48 9 PRO A 88 ? ? -69.77 1.00 49 10 SER A 6 ? ? -162.25 116.82 50 10 ARG A 19 ? ? 35.28 47.54 51 10 VAL A 42 ? ? 35.60 46.03 52 10 LYS A 79 ? ? -60.42 89.55 53 10 PRO A 85 ? ? -69.80 -177.70 54 11 SER A 5 ? ? 35.79 42.43 55 11 ARG A 19 ? ? 36.62 43.57 56 11 ILE A 34 ? ? -41.63 -70.59 57 11 LEU A 47 ? ? -52.46 96.84 58 11 LYS A 79 ? ? -59.24 99.53 59 11 PRO A 85 ? ? -69.77 -177.71 60 12 SER A 2 ? ? -54.66 172.53 61 12 ARG A 19 ? ? 35.28 48.42 62 12 LEU A 47 ? ? -65.81 97.87 63 12 LYS A 79 ? ? -62.89 82.54 64 12 PRO A 85 ? ? -69.72 -178.62 65 13 LEU A 33 ? ? -64.13 -70.35 66 13 VAL A 42 ? ? 36.87 44.48 67 13 LEU A 47 ? ? -52.61 95.97 68 13 LYS A 79 ? ? -61.78 86.90 69 13 PRO A 85 ? ? -69.77 -172.33 70 14 ARG A 19 ? ? 36.74 49.24 71 14 LEU A 47 ? ? -47.83 97.91 72 14 ASP A 70 ? ? -39.40 153.82 73 14 PRO A 85 ? ? -69.82 -177.08 74 15 LYS A 79 ? ? -59.39 77.48 75 15 PRO A 85 ? ? -69.79 -177.99 76 16 SER A 3 ? ? 37.29 41.90 77 16 SER A 6 ? ? -41.58 99.52 78 16 ARG A 19 ? ? 36.34 45.46 79 16 LEU A 38 ? ? -37.41 -39.06 80 16 LYS A 79 ? ? -63.46 93.59 81 16 PRO A 85 ? ? -69.71 -179.28 82 17 PRO A 8 ? ? -69.77 -177.30 83 17 ARG A 19 ? ? 35.71 46.14 84 17 LEU A 47 ? ? -51.77 100.93 85 17 LYS A 79 ? ? -59.91 77.55 86 17 PRO A 85 ? ? -69.81 -177.59 87 18 ASN A 16 ? ? -59.59 178.70 88 18 LEU A 33 ? ? -61.71 -70.64 89 18 LEU A 68 ? ? -48.38 169.17 90 18 LYS A 79 ? ? -61.64 93.83 91 18 PRO A 85 ? ? -69.76 -179.16 92 19 SER A 2 ? ? -41.82 160.78 93 19 ARG A 19 ? ? 34.04 47.74 94 19 PRO A 85 ? ? -69.77 -179.77 95 19 SER A 89 ? ? -162.77 108.58 96 20 SER A 3 ? ? 37.78 42.55 97 20 ARG A 19 ? ? 34.16 44.73 98 20 VAL A 42 ? ? 37.86 44.94 99 20 LEU A 47 ? ? -54.42 104.18 100 20 LYS A 79 ? ? -61.72 84.44 101 20 PRO A 85 ? ? -69.80 -177.89 #