data_2EGE # _entry.id 2EGE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EGE pdb_00002ege 10.2210/pdb2ege/pdb RCSB RCSB026632 ? ? WWPDB D_1000026632 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-28 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EGE _pdbx_database_status.recvd_initial_deposition_date 2007-02-28 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002001638.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Inoue, K.' 1 'Nagashima, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the third SH3 domain from human KIAA1666 protein' _citation.journal_abbrev 'to be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Inoue, K.' 1 ? primary 'Nagashima, T.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein KIAA1666' _entity.formula_weight 7793.755 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGKIMIAALDYDPGDGQMGGQGKGRLALRAGDVVMVYGPMDDQGFYYGELGGHRGLVPAHLLDHMSLHGH _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGKIMIAALDYDPGDGQMGGQGKGRLALRAGDVVMVYGPMDDQGFYYGELGGHRGLVPAHLLDHMSLHGH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002001638.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LYS n 1 9 ILE n 1 10 MET n 1 11 ILE n 1 12 ALA n 1 13 ALA n 1 14 LEU n 1 15 ASP n 1 16 TYR n 1 17 ASP n 1 18 PRO n 1 19 GLY n 1 20 ASP n 1 21 GLY n 1 22 GLN n 1 23 MET n 1 24 GLY n 1 25 GLY n 1 26 GLN n 1 27 GLY n 1 28 LYS n 1 29 GLY n 1 30 ARG n 1 31 LEU n 1 32 ALA n 1 33 LEU n 1 34 ARG n 1 35 ALA n 1 36 GLY n 1 37 ASP n 1 38 VAL n 1 39 VAL n 1 40 MET n 1 41 VAL n 1 42 TYR n 1 43 GLY n 1 44 PRO n 1 45 MET n 1 46 ASP n 1 47 ASP n 1 48 GLN n 1 49 GLY n 1 50 PHE n 1 51 TYR n 1 52 TYR n 1 53 GLY n 1 54 GLU n 1 55 LEU n 1 56 GLY n 1 57 GLY n 1 58 HIS n 1 59 ARG n 1 60 GLY n 1 61 LEU n 1 62 VAL n 1 63 PRO n 1 64 ALA n 1 65 HIS n 1 66 LEU n 1 67 LEU n 1 68 ASP n 1 69 HIS n 1 70 MET n 1 71 SER n 1 72 LEU n 1 73 HIS n 1 74 GLY n 1 75 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene KIAA1666 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060227-11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 HIS 75 75 75 HIS HIS A . n # _exptl.entry_id 2EGE _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2EGE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2EGE _struct.title 'Solution structure of the third SH3 domain from human KIAA1666 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EGE _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;SH3 domain, KIAA1666 protein, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code K1666_HUMAN _struct_ref.pdbx_db_accession Q9UFD9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KIMIAALDYDPGDGQMGGQGKGRLALRAGDVVMVYGPMDDQGFYYGELGGHRGLVPAHLLDHMSLHGH _struct_ref.pdbx_align_begin 1478 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EGE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UFD9 _struct_ref_seq.db_align_beg 1478 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1545 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EGE GLY A 1 ? UNP Q9UFD9 ? ? 'expression tag' 1 1 1 2EGE SER A 2 ? UNP Q9UFD9 ? ? 'expression tag' 2 2 1 2EGE SER A 3 ? UNP Q9UFD9 ? ? 'expression tag' 3 3 1 2EGE GLY A 4 ? UNP Q9UFD9 ? ? 'expression tag' 4 4 1 2EGE SER A 5 ? UNP Q9UFD9 ? ? 'expression tag' 5 5 1 2EGE SER A 6 ? UNP Q9UFD9 ? ? 'expression tag' 6 6 1 2EGE GLY A 7 ? UNP Q9UFD9 ? ? 'expression tag' 7 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 59 ? PRO A 63 ? ARG A 59 PRO A 63 A 2 PHE A 50 ? GLU A 54 ? PHE A 50 GLU A 54 A 3 VAL A 38 ? TYR A 42 ? VAL A 38 TYR A 42 A 4 LYS A 8 ? ALA A 12 ? LYS A 8 ALA A 12 A 5 LEU A 67 ? HIS A 69 ? LEU A 67 HIS A 69 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 62 ? O VAL A 62 N TYR A 51 ? N TYR A 51 A 2 3 O GLU A 54 ? O GLU A 54 N MET A 40 ? N MET A 40 A 3 4 O VAL A 39 ? O VAL A 39 N MET A 10 ? N MET A 10 A 4 5 N ILE A 11 ? N ILE A 11 O ASP A 68 ? O ASP A 68 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 17 ? ? -117.45 73.98 2 1 GLN A 22 ? ? -55.68 171.85 3 1 MET A 23 ? ? -57.02 172.64 4 1 ALA A 35 ? ? -51.71 103.05 5 1 VAL A 38 ? ? -69.18 99.10 6 1 PRO A 44 ? ? -69.71 -171.50 7 2 ASP A 17 ? ? -119.65 74.02 8 2 ALA A 35 ? ? -53.89 102.15 9 2 PRO A 44 ? ? -69.73 -171.42 10 3 ASP A 17 ? ? -115.60 73.57 11 3 GLN A 22 ? ? -58.39 173.19 12 3 ALA A 35 ? ? -51.38 103.25 13 3 VAL A 38 ? ? -69.10 95.70 14 3 PRO A 44 ? ? -69.75 -171.76 15 4 ASP A 17 ? ? -118.96 73.78 16 4 ALA A 35 ? ? -53.59 101.80 17 4 PRO A 44 ? ? -69.83 -171.03 18 5 ASP A 17 ? ? -118.81 73.73 19 5 ALA A 35 ? ? -54.58 101.33 20 5 PRO A 44 ? ? -69.79 -170.93 21 6 ASP A 17 ? ? -115.36 73.83 22 6 ALA A 35 ? ? -53.12 102.42 23 6 PRO A 44 ? ? -69.75 -171.45 24 7 ASP A 17 ? ? -115.61 73.84 25 7 ALA A 35 ? ? -54.10 101.45 26 7 PRO A 44 ? ? -69.80 -170.84 27 8 ASP A 17 ? ? -113.74 73.74 28 8 ALA A 35 ? ? -51.65 103.18 29 8 VAL A 38 ? ? -69.39 99.40 30 8 PRO A 44 ? ? -69.76 -170.92 31 9 ALA A 35 ? ? -55.21 100.92 32 9 PRO A 44 ? ? -69.83 -170.88 33 10 ASP A 17 ? ? -116.65 73.89 34 10 MET A 23 ? ? -56.91 109.58 35 10 GLN A 26 ? ? -95.06 -61.12 36 10 ALA A 35 ? ? -51.41 103.49 37 10 PRO A 44 ? ? -69.73 -171.66 38 11 ASP A 17 ? ? -117.33 73.78 39 11 ALA A 35 ? ? -54.90 101.20 40 11 PRO A 44 ? ? -69.81 -171.00 41 12 SER A 3 ? ? -92.23 -64.94 42 12 ASP A 17 ? ? -116.45 73.66 43 12 ALA A 35 ? ? -51.80 103.20 44 12 PRO A 44 ? ? -69.74 -170.97 45 13 ASP A 17 ? ? -117.22 73.62 46 13 ALA A 35 ? ? -51.28 104.09 47 13 VAL A 38 ? ? -69.41 98.86 48 13 PRO A 44 ? ? -69.78 -171.61 49 14 ALA A 35 ? ? -51.55 103.81 50 14 VAL A 38 ? ? -69.66 97.23 51 14 PRO A 44 ? ? -69.81 -172.94 52 15 ASP A 17 ? ? -113.21 75.56 53 15 ALA A 35 ? ? -51.62 103.11 54 15 PRO A 44 ? ? -69.74 -171.10 55 16 ALA A 35 ? ? -51.46 103.15 56 16 PRO A 44 ? ? -69.77 -171.60 57 17 ALA A 35 ? ? -52.72 102.21 58 17 TYR A 42 ? ? -132.36 -77.58 59 18 ASP A 20 ? ? -63.28 -179.10 60 18 GLN A 22 ? ? 39.20 42.20 61 18 ALA A 35 ? ? -52.71 102.54 62 18 VAL A 38 ? ? -69.34 99.96 63 18 PRO A 44 ? ? -69.75 -170.94 64 18 MET A 70 ? ? -53.97 -72.04 65 19 ASP A 20 ? ? -54.48 173.85 66 19 GLN A 22 ? ? 39.56 41.63 67 19 ALA A 35 ? ? -54.58 104.56 68 19 PRO A 44 ? ? -69.71 -171.46 69 20 SER A 6 ? ? -90.98 -70.86 70 20 ASP A 17 ? ? -117.40 73.90 71 20 LYS A 28 ? ? 39.71 39.74 72 20 ALA A 35 ? ? -53.44 102.16 73 20 PRO A 44 ? ? -69.74 -170.95 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2EGE _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EGE _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.01mM U-15N, 13C-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2EGE _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20060324 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9807 'Kobayashi, N.' 4 'structure solution' CYANA 2.1 'Guntert, P.' 5 refinement CYANA 2.1 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HIS N N N N 106 HIS CA C N S 107 HIS C C N N 108 HIS O O N N 109 HIS CB C N N 110 HIS CG C Y N 111 HIS ND1 N Y N 112 HIS CD2 C Y N 113 HIS CE1 C Y N 114 HIS NE2 N Y N 115 HIS OXT O N N 116 HIS H H N N 117 HIS H2 H N N 118 HIS HA H N N 119 HIS HB2 H N N 120 HIS HB3 H N N 121 HIS HD1 H N N 122 HIS HD2 H N N 123 HIS HE1 H N N 124 HIS HE2 H N N 125 HIS HXT H N N 126 ILE N N N N 127 ILE CA C N S 128 ILE C C N N 129 ILE O O N N 130 ILE CB C N S 131 ILE CG1 C N N 132 ILE CG2 C N N 133 ILE CD1 C N N 134 ILE OXT O N N 135 ILE H H N N 136 ILE H2 H N N 137 ILE HA H N N 138 ILE HB H N N 139 ILE HG12 H N N 140 ILE HG13 H N N 141 ILE HG21 H N N 142 ILE HG22 H N N 143 ILE HG23 H N N 144 ILE HD11 H N N 145 ILE HD12 H N N 146 ILE HD13 H N N 147 ILE HXT H N N 148 LEU N N N N 149 LEU CA C N S 150 LEU C C N N 151 LEU O O N N 152 LEU CB C N N 153 LEU CG C N N 154 LEU CD1 C N N 155 LEU CD2 C N N 156 LEU OXT O N N 157 LEU H H N N 158 LEU H2 H N N 159 LEU HA H N N 160 LEU HB2 H N N 161 LEU HB3 H N N 162 LEU HG H N N 163 LEU HD11 H N N 164 LEU HD12 H N N 165 LEU HD13 H N N 166 LEU HD21 H N N 167 LEU HD22 H N N 168 LEU HD23 H N N 169 LEU HXT H N N 170 LYS N N N N 171 LYS CA C N S 172 LYS C C N N 173 LYS O O N N 174 LYS CB C N N 175 LYS CG C N N 176 LYS CD C N N 177 LYS CE C N N 178 LYS NZ N N N 179 LYS OXT O N N 180 LYS H H N N 181 LYS H2 H N N 182 LYS HA H N N 183 LYS HB2 H N N 184 LYS HB3 H N N 185 LYS HG2 H N N 186 LYS HG3 H N N 187 LYS HD2 H N N 188 LYS HD3 H N N 189 LYS HE2 H N N 190 LYS HE3 H N N 191 LYS HZ1 H N N 192 LYS HZ2 H N N 193 LYS HZ3 H N N 194 LYS HXT H N N 195 MET N N N N 196 MET CA C N S 197 MET C C N N 198 MET O O N N 199 MET CB C N N 200 MET CG C N N 201 MET SD S N N 202 MET CE C N N 203 MET OXT O N N 204 MET H H N N 205 MET H2 H N N 206 MET HA H N N 207 MET HB2 H N N 208 MET HB3 H N N 209 MET HG2 H N N 210 MET HG3 H N N 211 MET HE1 H N N 212 MET HE2 H N N 213 MET HE3 H N N 214 MET HXT H N N 215 PHE N N N N 216 PHE CA C N S 217 PHE C C N N 218 PHE O O N N 219 PHE CB C N N 220 PHE CG C Y N 221 PHE CD1 C Y N 222 PHE CD2 C Y N 223 PHE CE1 C Y N 224 PHE CE2 C Y N 225 PHE CZ C Y N 226 PHE OXT O N N 227 PHE H H N N 228 PHE H2 H N N 229 PHE HA H N N 230 PHE HB2 H N N 231 PHE HB3 H N N 232 PHE HD1 H N N 233 PHE HD2 H N N 234 PHE HE1 H N N 235 PHE HE2 H N N 236 PHE HZ H N N 237 PHE HXT H N N 238 PRO N N N N 239 PRO CA C N S 240 PRO C C N N 241 PRO O O N N 242 PRO CB C N N 243 PRO CG C N N 244 PRO CD C N N 245 PRO OXT O N N 246 PRO H H N N 247 PRO HA H N N 248 PRO HB2 H N N 249 PRO HB3 H N N 250 PRO HG2 H N N 251 PRO HG3 H N N 252 PRO HD2 H N N 253 PRO HD3 H N N 254 PRO HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 TYR N N N N 270 TYR CA C N S 271 TYR C C N N 272 TYR O O N N 273 TYR CB C N N 274 TYR CG C Y N 275 TYR CD1 C Y N 276 TYR CD2 C Y N 277 TYR CE1 C Y N 278 TYR CE2 C Y N 279 TYR CZ C Y N 280 TYR OH O N N 281 TYR OXT O N N 282 TYR H H N N 283 TYR H2 H N N 284 TYR HA H N N 285 TYR HB2 H N N 286 TYR HB3 H N N 287 TYR HD1 H N N 288 TYR HD2 H N N 289 TYR HE1 H N N 290 TYR HE2 H N N 291 TYR HH H N N 292 TYR HXT H N N 293 VAL N N N N 294 VAL CA C N S 295 VAL C C N N 296 VAL O O N N 297 VAL CB C N N 298 VAL CG1 C N N 299 VAL CG2 C N N 300 VAL OXT O N N 301 VAL H H N N 302 VAL H2 H N N 303 VAL HA H N N 304 VAL HB H N N 305 VAL HG11 H N N 306 VAL HG12 H N N 307 VAL HG13 H N N 308 VAL HG21 H N N 309 VAL HG22 H N N 310 VAL HG23 H N N 311 VAL HXT H N N 312 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HIS N CA sing N N 100 HIS N H sing N N 101 HIS N H2 sing N N 102 HIS CA C sing N N 103 HIS CA CB sing N N 104 HIS CA HA sing N N 105 HIS C O doub N N 106 HIS C OXT sing N N 107 HIS CB CG sing N N 108 HIS CB HB2 sing N N 109 HIS CB HB3 sing N N 110 HIS CG ND1 sing Y N 111 HIS CG CD2 doub Y N 112 HIS ND1 CE1 doub Y N 113 HIS ND1 HD1 sing N N 114 HIS CD2 NE2 sing Y N 115 HIS CD2 HD2 sing N N 116 HIS CE1 NE2 sing Y N 117 HIS CE1 HE1 sing N N 118 HIS NE2 HE2 sing N N 119 HIS OXT HXT sing N N 120 ILE N CA sing N N 121 ILE N H sing N N 122 ILE N H2 sing N N 123 ILE CA C sing N N 124 ILE CA CB sing N N 125 ILE CA HA sing N N 126 ILE C O doub N N 127 ILE C OXT sing N N 128 ILE CB CG1 sing N N 129 ILE CB CG2 sing N N 130 ILE CB HB sing N N 131 ILE CG1 CD1 sing N N 132 ILE CG1 HG12 sing N N 133 ILE CG1 HG13 sing N N 134 ILE CG2 HG21 sing N N 135 ILE CG2 HG22 sing N N 136 ILE CG2 HG23 sing N N 137 ILE CD1 HD11 sing N N 138 ILE CD1 HD12 sing N N 139 ILE CD1 HD13 sing N N 140 ILE OXT HXT sing N N 141 LEU N CA sing N N 142 LEU N H sing N N 143 LEU N H2 sing N N 144 LEU CA C sing N N 145 LEU CA CB sing N N 146 LEU CA HA sing N N 147 LEU C O doub N N 148 LEU C OXT sing N N 149 LEU CB CG sing N N 150 LEU CB HB2 sing N N 151 LEU CB HB3 sing N N 152 LEU CG CD1 sing N N 153 LEU CG CD2 sing N N 154 LEU CG HG sing N N 155 LEU CD1 HD11 sing N N 156 LEU CD1 HD12 sing N N 157 LEU CD1 HD13 sing N N 158 LEU CD2 HD21 sing N N 159 LEU CD2 HD22 sing N N 160 LEU CD2 HD23 sing N N 161 LEU OXT HXT sing N N 162 LYS N CA sing N N 163 LYS N H sing N N 164 LYS N H2 sing N N 165 LYS CA C sing N N 166 LYS CA CB sing N N 167 LYS CA HA sing N N 168 LYS C O doub N N 169 LYS C OXT sing N N 170 LYS CB CG sing N N 171 LYS CB HB2 sing N N 172 LYS CB HB3 sing N N 173 LYS CG CD sing N N 174 LYS CG HG2 sing N N 175 LYS CG HG3 sing N N 176 LYS CD CE sing N N 177 LYS CD HD2 sing N N 178 LYS CD HD3 sing N N 179 LYS CE NZ sing N N 180 LYS CE HE2 sing N N 181 LYS CE HE3 sing N N 182 LYS NZ HZ1 sing N N 183 LYS NZ HZ2 sing N N 184 LYS NZ HZ3 sing N N 185 LYS OXT HXT sing N N 186 MET N CA sing N N 187 MET N H sing N N 188 MET N H2 sing N N 189 MET CA C sing N N 190 MET CA CB sing N N 191 MET CA HA sing N N 192 MET C O doub N N 193 MET C OXT sing N N 194 MET CB CG sing N N 195 MET CB HB2 sing N N 196 MET CB HB3 sing N N 197 MET CG SD sing N N 198 MET CG HG2 sing N N 199 MET CG HG3 sing N N 200 MET SD CE sing N N 201 MET CE HE1 sing N N 202 MET CE HE2 sing N N 203 MET CE HE3 sing N N 204 MET OXT HXT sing N N 205 PHE N CA sing N N 206 PHE N H sing N N 207 PHE N H2 sing N N 208 PHE CA C sing N N 209 PHE CA CB sing N N 210 PHE CA HA sing N N 211 PHE C O doub N N 212 PHE C OXT sing N N 213 PHE CB CG sing N N 214 PHE CB HB2 sing N N 215 PHE CB HB3 sing N N 216 PHE CG CD1 doub Y N 217 PHE CG CD2 sing Y N 218 PHE CD1 CE1 sing Y N 219 PHE CD1 HD1 sing N N 220 PHE CD2 CE2 doub Y N 221 PHE CD2 HD2 sing N N 222 PHE CE1 CZ doub Y N 223 PHE CE1 HE1 sing N N 224 PHE CE2 CZ sing Y N 225 PHE CE2 HE2 sing N N 226 PHE CZ HZ sing N N 227 PHE OXT HXT sing N N 228 PRO N CA sing N N 229 PRO N CD sing N N 230 PRO N H sing N N 231 PRO CA C sing N N 232 PRO CA CB sing N N 233 PRO CA HA sing N N 234 PRO C O doub N N 235 PRO C OXT sing N N 236 PRO CB CG sing N N 237 PRO CB HB2 sing N N 238 PRO CB HB3 sing N N 239 PRO CG CD sing N N 240 PRO CG HG2 sing N N 241 PRO CG HG3 sing N N 242 PRO CD HD2 sing N N 243 PRO CD HD3 sing N N 244 PRO OXT HXT sing N N 245 SER N CA sing N N 246 SER N H sing N N 247 SER N H2 sing N N 248 SER CA C sing N N 249 SER CA CB sing N N 250 SER CA HA sing N N 251 SER C O doub N N 252 SER C OXT sing N N 253 SER CB OG sing N N 254 SER CB HB2 sing N N 255 SER CB HB3 sing N N 256 SER OG HG sing N N 257 SER OXT HXT sing N N 258 TYR N CA sing N N 259 TYR N H sing N N 260 TYR N H2 sing N N 261 TYR CA C sing N N 262 TYR CA CB sing N N 263 TYR CA HA sing N N 264 TYR C O doub N N 265 TYR C OXT sing N N 266 TYR CB CG sing N N 267 TYR CB HB2 sing N N 268 TYR CB HB3 sing N N 269 TYR CG CD1 doub Y N 270 TYR CG CD2 sing Y N 271 TYR CD1 CE1 sing Y N 272 TYR CD1 HD1 sing N N 273 TYR CD2 CE2 doub Y N 274 TYR CD2 HD2 sing N N 275 TYR CE1 CZ doub Y N 276 TYR CE1 HE1 sing N N 277 TYR CE2 CZ sing Y N 278 TYR CE2 HE2 sing N N 279 TYR CZ OH sing N N 280 TYR OH HH sing N N 281 TYR OXT HXT sing N N 282 VAL N CA sing N N 283 VAL N H sing N N 284 VAL N H2 sing N N 285 VAL CA C sing N N 286 VAL CA CB sing N N 287 VAL CA HA sing N N 288 VAL C O doub N N 289 VAL C OXT sing N N 290 VAL CB CG1 sing N N 291 VAL CB CG2 sing N N 292 VAL CB HB sing N N 293 VAL CG1 HG11 sing N N 294 VAL CG1 HG12 sing N N 295 VAL CG1 HG13 sing N N 296 VAL CG2 HG21 sing N N 297 VAL CG2 HG22 sing N N 298 VAL CG2 HG23 sing N N 299 VAL OXT HXT sing N N 300 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2EGE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_