data_2ENT # _entry.id 2ENT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2ENT pdb_00002ent 10.2210/pdb2ent/pdb RCSB RCSB026887 ? ? WWPDB D_1000026887 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-01 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_conn 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 3 'Structure model' '_struct_ref_seq_dif.details' 17 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2ENT _pdbx_database_status.recvd_initial_deposition_date 2007-03-28 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002021967.4 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nagashima, T.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the second C2H2-type zinc finger domain from human Krueppel-like factor 15' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nagashima, T.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Krueppel-like factor 15' 5017.437 1 ? ? 'zf-C2H2, UNP residues 346-380' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Kidney-enriched krueppel-like factor' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002021967.4 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 THR n 1 9 GLY n 1 10 GLU n 1 11 LYS n 1 12 PRO n 1 13 PHE n 1 14 ALA n 1 15 CYS n 1 16 THR n 1 17 TRP n 1 18 PRO n 1 19 GLY n 1 20 CYS n 1 21 GLY n 1 22 TRP n 1 23 ARG n 1 24 PHE n 1 25 SER n 1 26 ARG n 1 27 SER n 1 28 ASP n 1 29 GLU n 1 30 LEU n 1 31 SER n 1 32 ARG n 1 33 HIS n 1 34 ARG n 1 35 ARG n 1 36 SER n 1 37 HIS n 1 38 SER n 1 39 GLY n 1 40 VAL n 1 41 LYS n 1 42 PRO n 1 43 SER n 1 44 GLY n 1 45 PRO n 1 46 SER n 1 47 SER n 1 48 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P070207-15 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 339 339 GLY GLY A . n A 1 2 SER 2 340 340 SER SER A . n A 1 3 SER 3 341 341 SER SER A . n A 1 4 GLY 4 342 342 GLY GLY A . n A 1 5 SER 5 343 343 SER SER A . n A 1 6 SER 6 344 344 SER SER A . n A 1 7 GLY 7 345 345 GLY GLY A . n A 1 8 THR 8 346 346 THR THR A . n A 1 9 GLY 9 347 347 GLY GLY A . n A 1 10 GLU 10 348 348 GLU GLU A . n A 1 11 LYS 11 349 349 LYS LYS A . n A 1 12 PRO 12 350 350 PRO PRO A . n A 1 13 PHE 13 351 351 PHE PHE A . n A 1 14 ALA 14 352 352 ALA ALA A . n A 1 15 CYS 15 353 353 CYS CYS A . n A 1 16 THR 16 354 354 THR THR A . n A 1 17 TRP 17 355 355 TRP TRP A . n A 1 18 PRO 18 356 356 PRO PRO A . n A 1 19 GLY 19 357 357 GLY GLY A . n A 1 20 CYS 20 358 358 CYS CYS A . n A 1 21 GLY 21 359 359 GLY GLY A . n A 1 22 TRP 22 360 360 TRP TRP A . n A 1 23 ARG 23 361 361 ARG ARG A . n A 1 24 PHE 24 362 362 PHE PHE A . n A 1 25 SER 25 363 363 SER SER A . n A 1 26 ARG 26 364 364 ARG ARG A . n A 1 27 SER 27 365 365 SER SER A . n A 1 28 ASP 28 366 366 ASP ASP A . n A 1 29 GLU 29 367 367 GLU GLU A . n A 1 30 LEU 30 368 368 LEU LEU A . n A 1 31 SER 31 369 369 SER SER A . n A 1 32 ARG 32 370 370 ARG ARG A . n A 1 33 HIS 33 371 371 HIS HIS A . n A 1 34 ARG 34 372 372 ARG ARG A . n A 1 35 ARG 35 373 373 ARG ARG A . n A 1 36 SER 36 374 374 SER SER A . n A 1 37 HIS 37 375 375 HIS HIS A . n A 1 38 SER 38 376 376 SER SER A . n A 1 39 GLY 39 377 377 GLY GLY A . n A 1 40 VAL 40 378 378 VAL VAL A . n A 1 41 LYS 41 379 379 LYS LYS A . n A 1 42 PRO 42 380 380 PRO PRO A . n A 1 43 SER 43 381 381 SER SER A . n A 1 44 GLY 44 382 382 GLY GLY A . n A 1 45 PRO 45 383 383 PRO PRO A . n A 1 46 SER 46 384 384 SER SER A . n A 1 47 SER 47 385 385 SER SER A . n A 1 48 GLY 48 386 386 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 200 _pdbx_nonpoly_scheme.auth_seq_num 200 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 2ENT _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2ENT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2ENT _struct.title 'Solution structure of the second C2H2-type zinc finger domain from human Krueppel-like factor 15' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ENT _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;zinc binding, transcription factor, adipogenesis, CLCNKA, Chloride channel Ka, rhodopsin, IRBP, Interstitial retinol-binding protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KLF15_HUMAN _struct_ref.pdbx_db_accession Q9UIH9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKP _struct_ref.pdbx_align_begin 346 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ENT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 42 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UIH9 _struct_ref_seq.db_align_beg 346 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 380 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 346 _struct_ref_seq.pdbx_auth_seq_align_end 380 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2ENT GLY A 1 ? UNP Q9UIH9 ? ? 'expression tag' 339 1 1 2ENT SER A 2 ? UNP Q9UIH9 ? ? 'expression tag' 340 2 1 2ENT SER A 3 ? UNP Q9UIH9 ? ? 'expression tag' 341 3 1 2ENT GLY A 4 ? UNP Q9UIH9 ? ? 'expression tag' 342 4 1 2ENT SER A 5 ? UNP Q9UIH9 ? ? 'expression tag' 343 5 1 2ENT SER A 6 ? UNP Q9UIH9 ? ? 'expression tag' 344 6 1 2ENT GLY A 7 ? UNP Q9UIH9 ? ? 'expression tag' 345 7 1 2ENT SER A 43 ? UNP Q9UIH9 ? ? 'expression tag' 381 8 1 2ENT GLY A 44 ? UNP Q9UIH9 ? ? 'expression tag' 382 9 1 2ENT PRO A 45 ? UNP Q9UIH9 ? ? 'expression tag' 383 10 1 2ENT SER A 46 ? UNP Q9UIH9 ? ? 'expression tag' 384 11 1 2ENT SER A 47 ? UNP Q9UIH9 ? ? 'expression tag' 385 12 1 2ENT GLY A 48 ? UNP Q9UIH9 ? ? 'expression tag' 386 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 26 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 35 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 364 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 373 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 15 SG ? ? A ZN 200 A CYS 353 1_555 ? ? ? ? ? ? ? 2.318 ? ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 20 SG ? ? A ZN 200 A CYS 358 1_555 ? ? ? ? ? ? ? 2.257 ? ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 33 NE2 ? ? A ZN 200 A HIS 371 1_555 ? ? ? ? ? ? ? 1.998 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 37 NE2 ? ? A ZN 200 A HIS 375 1_555 ? ? ? ? ? ? ? 2.039 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 15 ? A CYS 353 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 20 ? A CYS 358 ? 1_555 105.9 ? 2 SG ? A CYS 15 ? A CYS 353 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 33 ? A HIS 371 ? 1_555 112.2 ? 3 SG ? A CYS 20 ? A CYS 358 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 33 ? A HIS 371 ? 1_555 113.8 ? 4 SG ? A CYS 15 ? A CYS 353 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 37 ? A HIS 375 ? 1_555 112.4 ? 5 SG ? A CYS 20 ? A CYS 358 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 37 ? A HIS 375 ? 1_555 109.0 ? 6 NE2 ? A HIS 33 ? A HIS 371 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 37 ? A HIS 375 ? 1_555 103.7 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 13 ? ALA A 14 ? PHE A 351 ALA A 352 A 2 ARG A 23 ? PHE A 24 ? ARG A 361 PHE A 362 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id PHE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 13 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 351 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 24 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 362 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 200 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 200' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 15 ? CYS A 353 . ? 1_555 ? 2 AC1 4 TRP A 17 ? TRP A 355 . ? 1_555 ? 3 AC1 4 CYS A 20 ? CYS A 358 . ? 1_555 ? 4 AC1 4 TRP A 22 ? TRP A 360 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 353 ? ? -48.38 150.70 2 2 SER A 376 ? ? -93.28 49.11 3 3 SER A 341 ? ? -172.20 115.24 4 3 SER A 344 ? ? -101.12 41.95 5 4 PRO A 383 ? ? -69.75 0.85 6 4 SER A 384 ? ? -34.58 113.95 7 5 PHE A 351 ? ? -68.47 98.96 8 5 SER A 384 ? ? -88.62 41.63 9 7 PRO A 383 ? ? -69.74 87.40 10 8 SER A 376 ? ? -89.14 48.79 11 8 PRO A 380 ? ? -69.78 99.80 12 9 SER A 343 ? ? -59.51 96.06 13 9 PRO A 383 ? ? -69.73 87.49 14 10 SER A 341 ? ? -37.83 149.76 15 10 SER A 381 ? ? -34.60 137.18 16 10 PRO A 383 ? ? -69.77 2.60 17 10 SER A 384 ? ? -45.79 93.63 18 11 SER A 343 ? ? -63.80 81.99 19 11 PRO A 380 ? ? -69.81 -171.14 20 11 SER A 384 ? ? 37.41 42.08 21 12 CYS A 353 ? ? -49.55 153.95 22 12 VAL A 378 ? ? -98.06 52.57 23 13 PRO A 380 ? ? -69.80 -176.36 24 15 GLU A 348 ? ? -35.17 146.50 25 15 VAL A 378 ? ? -171.47 149.05 26 16 SER A 344 ? ? -90.69 41.27 27 16 SER A 381 ? ? -123.59 -62.01 28 17 PRO A 380 ? ? -69.81 -174.95 29 18 SER A 340 ? ? -39.65 121.05 30 18 SER A 344 ? ? -96.60 40.54 31 18 GLU A 348 ? ? -51.72 170.13 32 19 PHE A 351 ? ? -67.57 98.28 33 20 THR A 346 ? ? 38.36 40.64 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2ENT _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2ENT _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.18mM uniformly 13C,15N-labeled protein; 20mM TrisHCl; 100mM NaCl; 1mM DTT; 0.02% NaN3; 0.05mM ZnCl2; 1mM IDA; 10% D2O, 90% H2O' _pdbx_nmr_sample_details.solvent_system '10% D2O, 90% H2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2ENT _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20020425 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9822 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLU N N N N 71 GLU CA C N S 72 GLU C C N N 73 GLU O O N N 74 GLU CB C N N 75 GLU CG C N N 76 GLU CD C N N 77 GLU OE1 O N N 78 GLU OE2 O N N 79 GLU OXT O N N 80 GLU H H N N 81 GLU H2 H N N 82 GLU HA H N N 83 GLU HB2 H N N 84 GLU HB3 H N N 85 GLU HG2 H N N 86 GLU HG3 H N N 87 GLU HE2 H N N 88 GLU HXT H N N 89 GLY N N N N 90 GLY CA C N N 91 GLY C C N N 92 GLY O O N N 93 GLY OXT O N N 94 GLY H H N N 95 GLY H2 H N N 96 GLY HA2 H N N 97 GLY HA3 H N N 98 GLY HXT H N N 99 HIS N N N N 100 HIS CA C N S 101 HIS C C N N 102 HIS O O N N 103 HIS CB C N N 104 HIS CG C Y N 105 HIS ND1 N Y N 106 HIS CD2 C Y N 107 HIS CE1 C Y N 108 HIS NE2 N Y N 109 HIS OXT O N N 110 HIS H H N N 111 HIS H2 H N N 112 HIS HA H N N 113 HIS HB2 H N N 114 HIS HB3 H N N 115 HIS HD1 H N N 116 HIS HD2 H N N 117 HIS HE1 H N N 118 HIS HE2 H N N 119 HIS HXT H N N 120 LEU N N N N 121 LEU CA C N S 122 LEU C C N N 123 LEU O O N N 124 LEU CB C N N 125 LEU CG C N N 126 LEU CD1 C N N 127 LEU CD2 C N N 128 LEU OXT O N N 129 LEU H H N N 130 LEU H2 H N N 131 LEU HA H N N 132 LEU HB2 H N N 133 LEU HB3 H N N 134 LEU HG H N N 135 LEU HD11 H N N 136 LEU HD12 H N N 137 LEU HD13 H N N 138 LEU HD21 H N N 139 LEU HD22 H N N 140 LEU HD23 H N N 141 LEU HXT H N N 142 LYS N N N N 143 LYS CA C N S 144 LYS C C N N 145 LYS O O N N 146 LYS CB C N N 147 LYS CG C N N 148 LYS CD C N N 149 LYS CE C N N 150 LYS NZ N N N 151 LYS OXT O N N 152 LYS H H N N 153 LYS H2 H N N 154 LYS HA H N N 155 LYS HB2 H N N 156 LYS HB3 H N N 157 LYS HG2 H N N 158 LYS HG3 H N N 159 LYS HD2 H N N 160 LYS HD3 H N N 161 LYS HE2 H N N 162 LYS HE3 H N N 163 LYS HZ1 H N N 164 LYS HZ2 H N N 165 LYS HZ3 H N N 166 LYS HXT H N N 167 PHE N N N N 168 PHE CA C N S 169 PHE C C N N 170 PHE O O N N 171 PHE CB C N N 172 PHE CG C Y N 173 PHE CD1 C Y N 174 PHE CD2 C Y N 175 PHE CE1 C Y N 176 PHE CE2 C Y N 177 PHE CZ C Y N 178 PHE OXT O N N 179 PHE H H N N 180 PHE H2 H N N 181 PHE HA H N N 182 PHE HB2 H N N 183 PHE HB3 H N N 184 PHE HD1 H N N 185 PHE HD2 H N N 186 PHE HE1 H N N 187 PHE HE2 H N N 188 PHE HZ H N N 189 PHE HXT H N N 190 PRO N N N N 191 PRO CA C N S 192 PRO C C N N 193 PRO O O N N 194 PRO CB C N N 195 PRO CG C N N 196 PRO CD C N N 197 PRO OXT O N N 198 PRO H H N N 199 PRO HA H N N 200 PRO HB2 H N N 201 PRO HB3 H N N 202 PRO HG2 H N N 203 PRO HG3 H N N 204 PRO HD2 H N N 205 PRO HD3 H N N 206 PRO HXT H N N 207 SER N N N N 208 SER CA C N S 209 SER C C N N 210 SER O O N N 211 SER CB C N N 212 SER OG O N N 213 SER OXT O N N 214 SER H H N N 215 SER H2 H N N 216 SER HA H N N 217 SER HB2 H N N 218 SER HB3 H N N 219 SER HG H N N 220 SER HXT H N N 221 THR N N N N 222 THR CA C N S 223 THR C C N N 224 THR O O N N 225 THR CB C N R 226 THR OG1 O N N 227 THR CG2 C N N 228 THR OXT O N N 229 THR H H N N 230 THR H2 H N N 231 THR HA H N N 232 THR HB H N N 233 THR HG1 H N N 234 THR HG21 H N N 235 THR HG22 H N N 236 THR HG23 H N N 237 THR HXT H N N 238 TRP N N N N 239 TRP CA C N S 240 TRP C C N N 241 TRP O O N N 242 TRP CB C N N 243 TRP CG C Y N 244 TRP CD1 C Y N 245 TRP CD2 C Y N 246 TRP NE1 N Y N 247 TRP CE2 C Y N 248 TRP CE3 C Y N 249 TRP CZ2 C Y N 250 TRP CZ3 C Y N 251 TRP CH2 C Y N 252 TRP OXT O N N 253 TRP H H N N 254 TRP H2 H N N 255 TRP HA H N N 256 TRP HB2 H N N 257 TRP HB3 H N N 258 TRP HD1 H N N 259 TRP HE1 H N N 260 TRP HE3 H N N 261 TRP HZ2 H N N 262 TRP HZ3 H N N 263 TRP HH2 H N N 264 TRP HXT H N N 265 VAL N N N N 266 VAL CA C N S 267 VAL C C N N 268 VAL O O N N 269 VAL CB C N N 270 VAL CG1 C N N 271 VAL CG2 C N N 272 VAL OXT O N N 273 VAL H H N N 274 VAL H2 H N N 275 VAL HA H N N 276 VAL HB H N N 277 VAL HG11 H N N 278 VAL HG12 H N N 279 VAL HG13 H N N 280 VAL HG21 H N N 281 VAL HG22 H N N 282 VAL HG23 H N N 283 VAL HXT H N N 284 ZN ZN ZN N N 285 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLU N CA sing N N 67 GLU N H sing N N 68 GLU N H2 sing N N 69 GLU CA C sing N N 70 GLU CA CB sing N N 71 GLU CA HA sing N N 72 GLU C O doub N N 73 GLU C OXT sing N N 74 GLU CB CG sing N N 75 GLU CB HB2 sing N N 76 GLU CB HB3 sing N N 77 GLU CG CD sing N N 78 GLU CG HG2 sing N N 79 GLU CG HG3 sing N N 80 GLU CD OE1 doub N N 81 GLU CD OE2 sing N N 82 GLU OE2 HE2 sing N N 83 GLU OXT HXT sing N N 84 GLY N CA sing N N 85 GLY N H sing N N 86 GLY N H2 sing N N 87 GLY CA C sing N N 88 GLY CA HA2 sing N N 89 GLY CA HA3 sing N N 90 GLY C O doub N N 91 GLY C OXT sing N N 92 GLY OXT HXT sing N N 93 HIS N CA sing N N 94 HIS N H sing N N 95 HIS N H2 sing N N 96 HIS CA C sing N N 97 HIS CA CB sing N N 98 HIS CA HA sing N N 99 HIS C O doub N N 100 HIS C OXT sing N N 101 HIS CB CG sing N N 102 HIS CB HB2 sing N N 103 HIS CB HB3 sing N N 104 HIS CG ND1 sing Y N 105 HIS CG CD2 doub Y N 106 HIS ND1 CE1 doub Y N 107 HIS ND1 HD1 sing N N 108 HIS CD2 NE2 sing Y N 109 HIS CD2 HD2 sing N N 110 HIS CE1 NE2 sing Y N 111 HIS CE1 HE1 sing N N 112 HIS NE2 HE2 sing N N 113 HIS OXT HXT sing N N 114 LEU N CA sing N N 115 LEU N H sing N N 116 LEU N H2 sing N N 117 LEU CA C sing N N 118 LEU CA CB sing N N 119 LEU CA HA sing N N 120 LEU C O doub N N 121 LEU C OXT sing N N 122 LEU CB CG sing N N 123 LEU CB HB2 sing N N 124 LEU CB HB3 sing N N 125 LEU CG CD1 sing N N 126 LEU CG CD2 sing N N 127 LEU CG HG sing N N 128 LEU CD1 HD11 sing N N 129 LEU CD1 HD12 sing N N 130 LEU CD1 HD13 sing N N 131 LEU CD2 HD21 sing N N 132 LEU CD2 HD22 sing N N 133 LEU CD2 HD23 sing N N 134 LEU OXT HXT sing N N 135 LYS N CA sing N N 136 LYS N H sing N N 137 LYS N H2 sing N N 138 LYS CA C sing N N 139 LYS CA CB sing N N 140 LYS CA HA sing N N 141 LYS C O doub N N 142 LYS C OXT sing N N 143 LYS CB CG sing N N 144 LYS CB HB2 sing N N 145 LYS CB HB3 sing N N 146 LYS CG CD sing N N 147 LYS CG HG2 sing N N 148 LYS CG HG3 sing N N 149 LYS CD CE sing N N 150 LYS CD HD2 sing N N 151 LYS CD HD3 sing N N 152 LYS CE NZ sing N N 153 LYS CE HE2 sing N N 154 LYS CE HE3 sing N N 155 LYS NZ HZ1 sing N N 156 LYS NZ HZ2 sing N N 157 LYS NZ HZ3 sing N N 158 LYS OXT HXT sing N N 159 PHE N CA sing N N 160 PHE N H sing N N 161 PHE N H2 sing N N 162 PHE CA C sing N N 163 PHE CA CB sing N N 164 PHE CA HA sing N N 165 PHE C O doub N N 166 PHE C OXT sing N N 167 PHE CB CG sing N N 168 PHE CB HB2 sing N N 169 PHE CB HB3 sing N N 170 PHE CG CD1 doub Y N 171 PHE CG CD2 sing Y N 172 PHE CD1 CE1 sing Y N 173 PHE CD1 HD1 sing N N 174 PHE CD2 CE2 doub Y N 175 PHE CD2 HD2 sing N N 176 PHE CE1 CZ doub Y N 177 PHE CE1 HE1 sing N N 178 PHE CE2 CZ sing Y N 179 PHE CE2 HE2 sing N N 180 PHE CZ HZ sing N N 181 PHE OXT HXT sing N N 182 PRO N CA sing N N 183 PRO N CD sing N N 184 PRO N H sing N N 185 PRO CA C sing N N 186 PRO CA CB sing N N 187 PRO CA HA sing N N 188 PRO C O doub N N 189 PRO C OXT sing N N 190 PRO CB CG sing N N 191 PRO CB HB2 sing N N 192 PRO CB HB3 sing N N 193 PRO CG CD sing N N 194 PRO CG HG2 sing N N 195 PRO CG HG3 sing N N 196 PRO CD HD2 sing N N 197 PRO CD HD3 sing N N 198 PRO OXT HXT sing N N 199 SER N CA sing N N 200 SER N H sing N N 201 SER N H2 sing N N 202 SER CA C sing N N 203 SER CA CB sing N N 204 SER CA HA sing N N 205 SER C O doub N N 206 SER C OXT sing N N 207 SER CB OG sing N N 208 SER CB HB2 sing N N 209 SER CB HB3 sing N N 210 SER OG HG sing N N 211 SER OXT HXT sing N N 212 THR N CA sing N N 213 THR N H sing N N 214 THR N H2 sing N N 215 THR CA C sing N N 216 THR CA CB sing N N 217 THR CA HA sing N N 218 THR C O doub N N 219 THR C OXT sing N N 220 THR CB OG1 sing N N 221 THR CB CG2 sing N N 222 THR CB HB sing N N 223 THR OG1 HG1 sing N N 224 THR CG2 HG21 sing N N 225 THR CG2 HG22 sing N N 226 THR CG2 HG23 sing N N 227 THR OXT HXT sing N N 228 TRP N CA sing N N 229 TRP N H sing N N 230 TRP N H2 sing N N 231 TRP CA C sing N N 232 TRP CA CB sing N N 233 TRP CA HA sing N N 234 TRP C O doub N N 235 TRP C OXT sing N N 236 TRP CB CG sing N N 237 TRP CB HB2 sing N N 238 TRP CB HB3 sing N N 239 TRP CG CD1 doub Y N 240 TRP CG CD2 sing Y N 241 TRP CD1 NE1 sing Y N 242 TRP CD1 HD1 sing N N 243 TRP CD2 CE2 doub Y N 244 TRP CD2 CE3 sing Y N 245 TRP NE1 CE2 sing Y N 246 TRP NE1 HE1 sing N N 247 TRP CE2 CZ2 sing Y N 248 TRP CE3 CZ3 doub Y N 249 TRP CE3 HE3 sing N N 250 TRP CZ2 CH2 doub Y N 251 TRP CZ2 HZ2 sing N N 252 TRP CZ3 CH2 sing Y N 253 TRP CZ3 HZ3 sing N N 254 TRP CH2 HH2 sing N N 255 TRP OXT HXT sing N N 256 VAL N CA sing N N 257 VAL N H sing N N 258 VAL N H2 sing N N 259 VAL CA C sing N N 260 VAL CA CB sing N N 261 VAL CA HA sing N N 262 VAL C O doub N N 263 VAL C OXT sing N N 264 VAL CB CG1 sing N N 265 VAL CB CG2 sing N N 266 VAL CB HB sing N N 267 VAL CG1 HG11 sing N N 268 VAL CG1 HG12 sing N N 269 VAL CG1 HG13 sing N N 270 VAL CG2 HG21 sing N N 271 VAL CG2 HG22 sing N N 272 VAL CG2 HG23 sing N N 273 VAL OXT HXT sing N N 274 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2ENT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_