data_2EOC # _entry.id 2EOC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EOC pdb_00002eoc 10.2210/pdb2eoc/pdb RCSB RCSB026906 ? ? WWPDB D_1000026906 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk003000050.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EOC _pdbx_database_status.recvd_initial_deposition_date 2007-03-29 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nagashima, T.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the WGR domain from human poly [ADP-ribose] polymerase-3' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nagashima, T.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Poly [ADP-ribose] polymerase 3' _entity.formula_weight 14424.990 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.4.2.30 _entity.pdbx_mutation ? _entity.pdbx_fragment 'WGR domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PARP-3, NAD+, ADP- ribosyltransferase 3, Poly[ADP-ribose] synthetase 3, pADPRT-3, hPARP-3, IRT1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGAEKRIIRVDPTCPLSSNPGTQVYEDYNCTLNQTNIENNNNKFYIIQLLQDSNRFFTCWNRWGRVGEVGQSKIN HFTRLEDAKKDFEKKFREKTKNNWAERDHFVSHPGKYTLIEVQA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGAEKRIIRVDPTCPLSSNPGTQVYEDYNCTLNQTNIENNNNKFYIIQLLQDSNRFFTCWNRWGRVGEVGQSKIN HFTRLEDAKKDFEKKFREKTKNNWAERDHFVSHPGKYTLIEVQA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk003000050.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ALA n 1 9 GLU n 1 10 LYS n 1 11 ARG n 1 12 ILE n 1 13 ILE n 1 14 ARG n 1 15 VAL n 1 16 ASP n 1 17 PRO n 1 18 THR n 1 19 CYS n 1 20 PRO n 1 21 LEU n 1 22 SER n 1 23 SER n 1 24 ASN n 1 25 PRO n 1 26 GLY n 1 27 THR n 1 28 GLN n 1 29 VAL n 1 30 TYR n 1 31 GLU n 1 32 ASP n 1 33 TYR n 1 34 ASN n 1 35 CYS n 1 36 THR n 1 37 LEU n 1 38 ASN n 1 39 GLN n 1 40 THR n 1 41 ASN n 1 42 ILE n 1 43 GLU n 1 44 ASN n 1 45 ASN n 1 46 ASN n 1 47 ASN n 1 48 LYS n 1 49 PHE n 1 50 TYR n 1 51 ILE n 1 52 ILE n 1 53 GLN n 1 54 LEU n 1 55 LEU n 1 56 GLN n 1 57 ASP n 1 58 SER n 1 59 ASN n 1 60 ARG n 1 61 PHE n 1 62 PHE n 1 63 THR n 1 64 CYS n 1 65 TRP n 1 66 ASN n 1 67 ARG n 1 68 TRP n 1 69 GLY n 1 70 ARG n 1 71 VAL n 1 72 GLY n 1 73 GLU n 1 74 VAL n 1 75 GLY n 1 76 GLN n 1 77 SER n 1 78 LYS n 1 79 ILE n 1 80 ASN n 1 81 HIS n 1 82 PHE n 1 83 THR n 1 84 ARG n 1 85 LEU n 1 86 GLU n 1 87 ASP n 1 88 ALA n 1 89 LYS n 1 90 LYS n 1 91 ASP n 1 92 PHE n 1 93 GLU n 1 94 LYS n 1 95 LYS n 1 96 PHE n 1 97 ARG n 1 98 GLU n 1 99 LYS n 1 100 THR n 1 101 LYS n 1 102 ASN n 1 103 ASN n 1 104 TRP n 1 105 ALA n 1 106 GLU n 1 107 ARG n 1 108 ASP n 1 109 HIS n 1 110 PHE n 1 111 VAL n 1 112 SER n 1 113 HIS n 1 114 PRO n 1 115 GLY n 1 116 LYS n 1 117 TYR n 1 118 THR n 1 119 LEU n 1 120 ILE n 1 121 GLU n 1 122 VAL n 1 123 GLN n 1 124 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060710-01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PARP3_HUMAN _struct_ref.pdbx_db_accession Q9Y6F1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AEKRIIRVDPTCPLSSNPGTQVYEDYNCTLNQTNIENNNNKFYIIQLLQDSNRFFTCWNRWGRVGEVGQSKINHFTRLED AKKDFEKKFREKTKNNWAERDHFVSHPGKYTLIEVQA ; _struct_ref.pdbx_align_begin 41 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EOC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y6F1 _struct_ref_seq.db_align_beg 41 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 157 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 41 _struct_ref_seq.pdbx_auth_seq_align_end 157 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EOC GLY A 1 ? UNP Q9Y6F1 ? ? 'expression tag' 34 1 1 2EOC SER A 2 ? UNP Q9Y6F1 ? ? 'expression tag' 35 2 1 2EOC SER A 3 ? UNP Q9Y6F1 ? ? 'expression tag' 36 3 1 2EOC GLY A 4 ? UNP Q9Y6F1 ? ? 'expression tag' 37 4 1 2EOC SER A 5 ? UNP Q9Y6F1 ? ? 'expression tag' 38 5 1 2EOC SER A 6 ? UNP Q9Y6F1 ? ? 'expression tag' 39 6 1 2EOC GLY A 7 ? UNP Q9Y6F1 ? ? 'expression tag' 40 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.21mM uniformly 13C, 15N-labeled protein; 20mM TrisHCl, 100mM NaCl, 1mM DTT, 0.02% NaN3, 10% D2O, 90% H2O' _pdbx_nmr_sample_details.solvent_system '10% D2O / 90% H2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 900 ? 2 INOVA Varian 800 ? # _pdbx_nmr_refine.entry_id 2EOC _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2EOC _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EOC _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20020425 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9822 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2EOC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EOC _struct.title 'Solution structure of the WGR domain from human poly [ADP-ribose] polymerase-3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EOC _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;anti-parallel beta-sheet, cell cycle control, DNA damage, transcription, NAD+, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 84 ? LYS A 101 ? ARG A 117 LYS A 134 1 ? 18 HELX_P HELX_P2 2 GLU A 106 ? PHE A 110 ? GLU A 139 PHE A 143 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 78 ? PHE A 82 ? LYS A 111 PHE A 115 A 2 PHE A 62 ? ARG A 67 ? PHE A 95 ARG A 100 A 3 ASN A 46 ? GLN A 56 ? ASN A 79 GLN A 89 A 4 GLN A 28 ? ASN A 41 ? GLN A 61 ASN A 74 A 5 THR A 118 ? ILE A 120 ? THR A 151 ILE A 153 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 78 ? O LYS A 111 N ASN A 66 ? N ASN A 99 A 2 3 O THR A 63 ? O THR A 96 N LEU A 55 ? N LEU A 88 A 3 4 O LYS A 48 ? O LYS A 81 N GLN A 39 ? N GLN A 72 A 4 5 N THR A 36 ? N THR A 69 O ILE A 120 ? O ILE A 153 # _database_PDB_matrix.entry_id 2EOC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2EOC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 34 34 GLY GLY A . n A 1 2 SER 2 35 35 SER SER A . n A 1 3 SER 3 36 36 SER SER A . n A 1 4 GLY 4 37 37 GLY GLY A . n A 1 5 SER 5 38 38 SER SER A . n A 1 6 SER 6 39 39 SER SER A . n A 1 7 GLY 7 40 40 GLY GLY A . n A 1 8 ALA 8 41 41 ALA ALA A . n A 1 9 GLU 9 42 42 GLU GLU A . n A 1 10 LYS 10 43 43 LYS LYS A . n A 1 11 ARG 11 44 44 ARG ARG A . n A 1 12 ILE 12 45 45 ILE ILE A . n A 1 13 ILE 13 46 46 ILE ILE A . n A 1 14 ARG 14 47 47 ARG ARG A . n A 1 15 VAL 15 48 48 VAL VAL A . n A 1 16 ASP 16 49 49 ASP ASP A . n A 1 17 PRO 17 50 50 PRO PRO A . n A 1 18 THR 18 51 51 THR THR A . n A 1 19 CYS 19 52 52 CYS CYS A . n A 1 20 PRO 20 53 53 PRO PRO A . n A 1 21 LEU 21 54 54 LEU LEU A . n A 1 22 SER 22 55 55 SER SER A . n A 1 23 SER 23 56 56 SER SER A . n A 1 24 ASN 24 57 57 ASN ASN A . n A 1 25 PRO 25 58 58 PRO PRO A . n A 1 26 GLY 26 59 59 GLY GLY A . n A 1 27 THR 27 60 60 THR THR A . n A 1 28 GLN 28 61 61 GLN GLN A . n A 1 29 VAL 29 62 62 VAL VAL A . n A 1 30 TYR 30 63 63 TYR TYR A . n A 1 31 GLU 31 64 64 GLU GLU A . n A 1 32 ASP 32 65 65 ASP ASP A . n A 1 33 TYR 33 66 66 TYR TYR A . n A 1 34 ASN 34 67 67 ASN ASN A . n A 1 35 CYS 35 68 68 CYS CYS A . n A 1 36 THR 36 69 69 THR THR A . n A 1 37 LEU 37 70 70 LEU LEU A . n A 1 38 ASN 38 71 71 ASN ASN A . n A 1 39 GLN 39 72 72 GLN GLN A . n A 1 40 THR 40 73 73 THR THR A . n A 1 41 ASN 41 74 74 ASN ASN A . n A 1 42 ILE 42 75 75 ILE ILE A . n A 1 43 GLU 43 76 76 GLU GLU A . n A 1 44 ASN 44 77 77 ASN ASN A . n A 1 45 ASN 45 78 78 ASN ASN A . n A 1 46 ASN 46 79 79 ASN ASN A . n A 1 47 ASN 47 80 80 ASN ASN A . n A 1 48 LYS 48 81 81 LYS LYS A . n A 1 49 PHE 49 82 82 PHE PHE A . n A 1 50 TYR 50 83 83 TYR TYR A . n A 1 51 ILE 51 84 84 ILE ILE A . n A 1 52 ILE 52 85 85 ILE ILE A . n A 1 53 GLN 53 86 86 GLN GLN A . n A 1 54 LEU 54 87 87 LEU LEU A . n A 1 55 LEU 55 88 88 LEU LEU A . n A 1 56 GLN 56 89 89 GLN GLN A . n A 1 57 ASP 57 90 90 ASP ASP A . n A 1 58 SER 58 91 91 SER SER A . n A 1 59 ASN 59 92 92 ASN ASN A . n A 1 60 ARG 60 93 93 ARG ARG A . n A 1 61 PHE 61 94 94 PHE PHE A . n A 1 62 PHE 62 95 95 PHE PHE A . n A 1 63 THR 63 96 96 THR THR A . n A 1 64 CYS 64 97 97 CYS CYS A . n A 1 65 TRP 65 98 98 TRP TRP A . n A 1 66 ASN 66 99 99 ASN ASN A . n A 1 67 ARG 67 100 100 ARG ARG A . n A 1 68 TRP 68 101 101 TRP TRP A . n A 1 69 GLY 69 102 102 GLY GLY A . n A 1 70 ARG 70 103 103 ARG ARG A . n A 1 71 VAL 71 104 104 VAL VAL A . n A 1 72 GLY 72 105 105 GLY GLY A . n A 1 73 GLU 73 106 106 GLU GLU A . n A 1 74 VAL 74 107 107 VAL VAL A . n A 1 75 GLY 75 108 108 GLY GLY A . n A 1 76 GLN 76 109 109 GLN GLN A . n A 1 77 SER 77 110 110 SER SER A . n A 1 78 LYS 78 111 111 LYS LYS A . n A 1 79 ILE 79 112 112 ILE ILE A . n A 1 80 ASN 80 113 113 ASN ASN A . n A 1 81 HIS 81 114 114 HIS HIS A . n A 1 82 PHE 82 115 115 PHE PHE A . n A 1 83 THR 83 116 116 THR THR A . n A 1 84 ARG 84 117 117 ARG ARG A . n A 1 85 LEU 85 118 118 LEU LEU A . n A 1 86 GLU 86 119 119 GLU GLU A . n A 1 87 ASP 87 120 120 ASP ASP A . n A 1 88 ALA 88 121 121 ALA ALA A . n A 1 89 LYS 89 122 122 LYS LYS A . n A 1 90 LYS 90 123 123 LYS LYS A . n A 1 91 ASP 91 124 124 ASP ASP A . n A 1 92 PHE 92 125 125 PHE PHE A . n A 1 93 GLU 93 126 126 GLU GLU A . n A 1 94 LYS 94 127 127 LYS LYS A . n A 1 95 LYS 95 128 128 LYS LYS A . n A 1 96 PHE 96 129 129 PHE PHE A . n A 1 97 ARG 97 130 130 ARG ARG A . n A 1 98 GLU 98 131 131 GLU GLU A . n A 1 99 LYS 99 132 132 LYS LYS A . n A 1 100 THR 100 133 133 THR THR A . n A 1 101 LYS 101 134 134 LYS LYS A . n A 1 102 ASN 102 135 135 ASN ASN A . n A 1 103 ASN 103 136 136 ASN ASN A . n A 1 104 TRP 104 137 137 TRP TRP A . n A 1 105 ALA 105 138 138 ALA ALA A . n A 1 106 GLU 106 139 139 GLU GLU A . n A 1 107 ARG 107 140 140 ARG ARG A . n A 1 108 ASP 108 141 141 ASP ASP A . n A 1 109 HIS 109 142 142 HIS HIS A . n A 1 110 PHE 110 143 143 PHE PHE A . n A 1 111 VAL 111 144 144 VAL VAL A . n A 1 112 SER 112 145 145 SER SER A . n A 1 113 HIS 113 146 146 HIS HIS A . n A 1 114 PRO 114 147 147 PRO PRO A . n A 1 115 GLY 115 148 148 GLY GLY A . n A 1 116 LYS 116 149 149 LYS LYS A . n A 1 117 TYR 117 150 150 TYR TYR A . n A 1 118 THR 118 151 151 THR THR A . n A 1 119 LEU 119 152 152 LEU LEU A . n A 1 120 ILE 120 153 153 ILE ILE A . n A 1 121 GLU 121 154 154 GLU GLU A . n A 1 122 VAL 122 155 155 VAL VAL A . n A 1 123 GLN 123 156 156 GLN GLN A . n A 1 124 ALA 124 157 157 ALA ALA A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-01 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 35 ? ? -174.28 -179.11 2 1 SER A 36 ? ? 62.42 143.51 3 1 SER A 38 ? ? -177.48 140.62 4 1 SER A 39 ? ? 53.08 100.61 5 1 ALA A 41 ? ? 52.51 173.59 6 1 GLU A 64 ? ? 50.64 -144.86 7 1 ASN A 92 ? ? -99.89 37.14 8 1 GLU A 139 ? ? -91.61 35.39 9 1 HIS A 142 ? ? -98.77 35.85 10 1 PHE A 143 ? ? -54.96 107.32 11 1 LYS A 149 ? ? -68.66 -177.36 12 1 VAL A 155 ? ? 50.43 172.38 13 2 SER A 36 ? ? 77.99 -51.47 14 2 SER A 38 ? ? 49.04 94.40 15 2 SER A 39 ? ? -66.37 90.47 16 2 ASP A 49 ? ? -35.28 142.03 17 2 GLU A 64 ? ? 55.02 -146.00 18 2 ASN A 92 ? ? -85.05 45.08 19 2 ARG A 93 ? ? 36.60 35.44 20 2 LYS A 134 ? ? 35.04 39.30 21 2 VAL A 155 ? ? 50.45 172.78 22 3 SER A 35 ? ? -149.49 -56.27 23 3 SER A 36 ? ? 57.31 168.59 24 3 VAL A 48 ? ? -43.58 107.79 25 3 ASP A 49 ? ? -34.61 142.51 26 3 THR A 60 ? ? -57.98 104.72 27 3 GLU A 64 ? ? 41.40 -146.24 28 3 ASN A 92 ? ? -85.49 49.07 29 3 ARG A 93 ? ? 34.59 35.63 30 3 LYS A 134 ? ? 39.20 39.46 31 3 GLU A 139 ? ? -92.37 38.22 32 3 HIS A 142 ? ? -94.45 34.62 33 3 VAL A 155 ? ? 50.58 173.09 34 4 SER A 35 ? ? -170.95 133.29 35 4 SER A 36 ? ? 178.39 -59.65 36 4 ASP A 49 ? ? -36.18 141.86 37 4 THR A 60 ? ? -59.47 104.00 38 4 GLU A 64 ? ? 48.59 -144.64 39 4 ASP A 65 ? ? -105.67 44.35 40 4 ASN A 92 ? ? -81.35 49.95 41 4 ARG A 93 ? ? 32.13 36.10 42 4 GLN A 109 ? ? -59.25 173.19 43 4 HIS A 142 ? ? -108.48 50.12 44 4 VAL A 155 ? ? 50.71 172.62 45 5 SER A 38 ? ? -165.74 42.27 46 5 ASP A 49 ? ? -34.98 141.98 47 5 THR A 60 ? ? -66.68 93.77 48 5 TYR A 63 ? ? -53.90 99.17 49 5 GLU A 64 ? ? 72.48 -145.15 50 5 TYR A 83 ? ? -160.35 117.81 51 5 ASN A 92 ? ? -91.15 43.98 52 5 GLU A 139 ? ? -89.09 36.60 53 5 HIS A 142 ? ? -90.70 36.37 54 5 VAL A 155 ? ? 50.44 172.77 55 6 SER A 35 ? ? 63.15 130.14 56 6 SER A 36 ? ? -164.62 99.85 57 6 SER A 38 ? ? 61.66 118.75 58 6 ALA A 41 ? ? 66.80 115.98 59 6 THR A 60 ? ? -56.97 106.61 60 6 TYR A 63 ? ? -36.96 124.36 61 6 GLU A 64 ? ? 43.32 -146.01 62 6 ASP A 65 ? ? -107.06 41.58 63 6 ASN A 92 ? ? -85.47 47.30 64 6 ARG A 93 ? ? 31.98 36.49 65 6 LYS A 134 ? ? 38.73 36.99 66 6 GLU A 139 ? ? -92.33 36.49 67 6 HIS A 142 ? ? -95.84 36.56 68 6 VAL A 155 ? ? 50.36 172.48 69 7 SER A 35 ? ? -170.20 128.70 70 7 SER A 36 ? ? 176.95 132.01 71 7 SER A 38 ? ? -173.44 143.25 72 7 ASP A 49 ? ? -36.87 142.09 73 7 GLU A 64 ? ? 37.69 -143.43 74 7 ASP A 65 ? ? -107.23 42.19 75 7 ASN A 92 ? ? -91.63 45.53 76 7 ARG A 93 ? ? 39.54 43.14 77 7 GLU A 139 ? ? -91.38 37.67 78 7 HIS A 142 ? ? -99.29 40.17 79 7 PHE A 143 ? ? -55.76 109.59 80 7 VAL A 155 ? ? 50.37 172.85 81 8 SER A 36 ? ? 49.65 93.04 82 8 SER A 38 ? ? 47.31 83.13 83 8 LYS A 43 ? ? -45.62 162.38 84 8 ASP A 49 ? ? -35.89 141.62 85 8 LEU A 54 ? ? -38.37 -33.44 86 8 GLU A 64 ? ? 50.52 -145.38 87 8 ASP A 65 ? ? -108.81 40.68 88 8 ASN A 92 ? ? -99.83 39.21 89 8 PHE A 143 ? ? -54.59 105.01 90 8 VAL A 155 ? ? 44.54 -175.92 91 9 SER A 36 ? ? 36.93 84.16 92 9 SER A 38 ? ? -179.36 42.12 93 9 GLU A 64 ? ? 41.22 -143.49 94 9 ASN A 67 ? ? -163.13 108.01 95 9 ASN A 92 ? ? -94.33 37.41 96 9 ARG A 93 ? ? 39.10 37.90 97 9 LYS A 134 ? ? 34.20 40.53 98 9 GLU A 139 ? ? -91.86 39.55 99 9 HIS A 142 ? ? -99.59 41.08 100 9 PHE A 143 ? ? -56.78 103.10 101 9 VAL A 155 ? ? 50.41 172.65 102 10 SER A 38 ? ? 61.13 120.98 103 10 SER A 39 ? ? -159.57 42.10 104 10 ASP A 49 ? ? -37.32 142.28 105 10 TYR A 63 ? ? -38.69 116.24 106 10 GLU A 64 ? ? 47.42 -147.24 107 10 ASN A 92 ? ? -95.97 44.50 108 10 ARG A 93 ? ? 38.86 42.24 109 10 LYS A 134 ? ? 39.02 36.99 110 10 GLU A 139 ? ? -92.00 38.70 111 10 HIS A 142 ? ? -95.81 38.29 112 10 LYS A 149 ? ? -66.22 -176.09 113 10 VAL A 155 ? ? 50.68 172.80 114 11 SER A 39 ? ? -175.44 116.21 115 11 ALA A 41 ? ? -174.86 135.63 116 11 ASP A 49 ? ? -38.15 142.11 117 11 GLU A 64 ? ? 44.17 -143.47 118 11 ASN A 67 ? ? -160.36 107.69 119 11 ASN A 92 ? ? -99.00 34.35 120 11 ARG A 93 ? ? 44.69 26.56 121 11 LYS A 134 ? ? 41.05 26.63 122 11 GLU A 139 ? ? -90.37 35.16 123 11 HIS A 142 ? ? -95.95 35.26 124 11 PHE A 143 ? ? -57.97 108.36 125 11 VAL A 155 ? ? 50.25 172.83 126 12 SER A 38 ? ? -161.97 104.40 127 12 GLU A 42 ? ? -108.81 44.71 128 12 ASP A 49 ? ? -38.59 142.08 129 12 THR A 60 ? ? -59.12 106.77 130 12 GLU A 64 ? ? 47.53 -145.18 131 12 ASN A 92 ? ? -82.42 46.48 132 12 ARG A 93 ? ? 33.16 34.69 133 12 LYS A 134 ? ? 36.99 39.67 134 12 GLU A 139 ? ? -91.77 39.85 135 12 HIS A 142 ? ? -98.17 39.89 136 12 PHE A 143 ? ? -56.25 104.48 137 12 VAL A 155 ? ? 51.10 172.86 138 13 SER A 38 ? ? -177.08 129.03 139 13 ALA A 41 ? ? 64.84 142.17 140 13 LYS A 43 ? ? -34.68 115.70 141 13 LEU A 54 ? ? -37.02 -38.60 142 13 THR A 60 ? ? -55.99 107.88 143 13 GLU A 64 ? ? 51.06 -142.47 144 13 ASN A 67 ? ? -162.04 115.10 145 13 ASN A 92 ? ? -93.63 39.00 146 13 ARG A 93 ? ? 41.50 25.26 147 13 GLU A 139 ? ? -87.77 36.99 148 13 HIS A 142 ? ? -97.17 38.71 149 13 PHE A 143 ? ? -58.36 104.84 150 13 LYS A 149 ? ? -64.03 -175.66 151 13 VAL A 155 ? ? 47.69 179.38 152 14 SER A 38 ? ? -178.16 121.54 153 14 SER A 39 ? ? 58.17 157.96 154 14 ASP A 49 ? ? -39.76 143.78 155 14 GLU A 64 ? ? 46.39 -142.53 156 14 ASP A 65 ? ? -109.36 40.19 157 14 ASN A 92 ? ? -84.24 47.04 158 14 ARG A 93 ? ? 36.14 34.91 159 14 VAL A 104 ? ? -61.31 92.44 160 14 GLU A 139 ? ? -89.53 36.90 161 14 HIS A 142 ? ? -97.03 40.82 162 14 PHE A 143 ? ? -59.65 104.71 163 14 VAL A 155 ? ? 50.52 172.47 164 15 GLU A 42 ? ? -59.79 108.65 165 15 ASP A 49 ? ? -34.22 141.86 166 15 THR A 60 ? ? -59.62 101.74 167 15 GLU A 64 ? ? 57.28 -145.80 168 15 ASN A 92 ? ? -82.80 47.30 169 15 ARG A 93 ? ? 35.67 38.05 170 15 LYS A 134 ? ? 34.60 37.55 171 15 GLU A 139 ? ? -91.97 39.53 172 15 HIS A 142 ? ? -92.27 36.64 173 15 LYS A 149 ? ? -64.90 -179.57 174 15 VAL A 155 ? ? 45.21 -176.08 175 16 SER A 35 ? ? -167.04 101.20 176 16 SER A 39 ? ? -146.08 -45.86 177 16 ALA A 41 ? ? 62.05 125.76 178 16 ASP A 49 ? ? -39.95 142.39 179 16 GLU A 64 ? ? 46.93 -143.65 180 16 ASP A 65 ? ? -108.66 40.13 181 16 ASN A 92 ? ? -85.64 49.28 182 16 ARG A 93 ? ? 31.59 37.09 183 16 VAL A 155 ? ? 50.39 173.14 184 17 ALA A 41 ? ? 69.28 126.43 185 17 ASP A 49 ? ? -34.83 142.67 186 17 THR A 60 ? ? -60.24 97.16 187 17 TYR A 63 ? ? -35.26 131.80 188 17 GLU A 64 ? ? 34.37 -144.22 189 17 ASN A 92 ? ? -86.90 46.27 190 17 ARG A 93 ? ? 31.60 36.91 191 17 LYS A 134 ? ? 35.22 39.47 192 17 GLU A 139 ? ? -85.58 30.44 193 17 PHE A 143 ? ? -45.83 93.00 194 17 VAL A 155 ? ? 45.09 -175.11 195 18 SER A 35 ? ? 49.91 178.70 196 18 SER A 36 ? ? -151.78 -47.62 197 18 ALA A 41 ? ? 173.96 135.64 198 18 ARG A 44 ? ? -35.47 144.88 199 18 VAL A 48 ? ? -39.18 126.27 200 18 TYR A 63 ? ? -34.47 127.05 201 18 GLU A 64 ? ? 35.24 -147.28 202 18 ASP A 65 ? ? -97.80 31.57 203 18 ASN A 67 ? ? -159.92 88.91 204 18 ASN A 92 ? ? -95.49 37.65 205 18 LYS A 134 ? ? 34.14 36.89 206 18 GLU A 139 ? ? -97.08 35.78 207 18 HIS A 142 ? ? -91.42 34.47 208 18 VAL A 155 ? ? 44.85 -175.51 209 19 SER A 36 ? ? -42.12 151.56 210 19 SER A 39 ? ? 61.86 145.80 211 19 GLU A 42 ? ? -52.14 107.59 212 19 ASP A 49 ? ? -38.17 136.80 213 19 THR A 60 ? ? -59.71 104.63 214 19 GLU A 64 ? ? 54.84 -142.32 215 19 ASN A 92 ? ? -83.40 46.91 216 19 ARG A 93 ? ? 35.04 34.07 217 19 GLN A 109 ? ? -59.67 174.18 218 19 LYS A 134 ? ? 35.28 38.02 219 19 GLU A 139 ? ? -90.28 35.69 220 19 PHE A 143 ? ? -49.56 92.99 221 19 VAL A 155 ? ? 44.90 -174.92 222 20 SER A 36 ? ? -172.32 138.59 223 20 GLU A 64 ? ? 58.81 -141.39 224 20 ASP A 65 ? ? -109.17 43.18 225 20 GLU A 139 ? ? -92.11 35.23 226 20 HIS A 142 ? ? -98.78 40.75 227 20 VAL A 155 ? ? 50.49 172.42 #