data_2EOS # _entry.id 2EOS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EOS pdb_00002eos 10.2210/pdb2eos/pdb RCSB RCSB026922 ? ? WWPDB D_1000026922 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.entry_id 2EOS _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-03-29 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk003001594.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tochio, N.' 1 'Tomizawa, T.' 2 'Abe, H.' 3 'Saito, K.' 4 'Li, H.' 5 'Sato, M.' 6 'Koshiba, S.' 7 'Kobayashi, N.' 8 'Kigawa, T.' 9 'Yokoyama, S.' 10 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 11 # _citation.id primary _citation.title 'Solution structure of the C2H2 type zinc finger (region 626-654) of human B-cell lymphoma 6 protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tochio, N.' 1 ? primary 'Tomizawa, T.' 2 ? primary 'Abe, H.' 3 ? primary 'Saito, K.' 4 ? primary 'Li, H.' 5 ? primary 'Sato, M.' 6 ? primary 'Koshiba, S.' 7 ? primary 'Kobayashi, N.' 8 ? primary 'Kigawa, T.' 9 ? primary 'Yokoyama, S.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'B-cell lymphoma 6 protein' 4378.867 1 ? ? 'zf-C2H2 domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BCL-6, Zinc finger protein 51, LAZ-3 protein, BCL-5, Zinc finger and BTB domain-containing protein 27' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGGEKPYPCEICGTRFRHLQTLKSHLRIHTGSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGGEKPYPCEICGTRFRHLQTLKSHLRIHTGSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk003001594.2 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLY n 1 9 GLU n 1 10 LYS n 1 11 PRO n 1 12 TYR n 1 13 PRO n 1 14 CYS n 1 15 GLU n 1 16 ILE n 1 17 CYS n 1 18 GLY n 1 19 THR n 1 20 ARG n 1 21 PHE n 1 22 ARG n 1 23 HIS n 1 24 LEU n 1 25 GLN n 1 26 THR n 1 27 LEU n 1 28 LYS n 1 29 SER n 1 30 HIS n 1 31 LEU n 1 32 ARG n 1 33 ILE n 1 34 HIS n 1 35 THR n 1 36 GLY n 1 37 SER n 1 38 GLY n 1 39 PRO n 1 40 SER n 1 41 SER n 1 42 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene BCL6 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P070115-03 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLY 42 42 42 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2EOS _exptl.crystals_number ? # _struct.entry_id 2EOS _struct.title 'Solution structure of the C2H2 type zinc finger (region 626-654) of human B-cell lymphoma 6 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EOS _struct_keywords.text ;zf-C2H2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BCL6_HUMAN _struct_ref.pdbx_db_accession P41182 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GEKPYPCEICGTRFRHLQTLKSHLRIHTG _struct_ref.pdbx_align_begin 626 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EOS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P41182 _struct_ref_seq.db_align_beg 626 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 654 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 36 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EOS GLY A 1 ? UNP P41182 ? ? 'expression tag' 1 1 1 2EOS SER A 2 ? UNP P41182 ? ? 'expression tag' 2 2 1 2EOS SER A 3 ? UNP P41182 ? ? 'expression tag' 3 3 1 2EOS GLY A 4 ? UNP P41182 ? ? 'expression tag' 4 4 1 2EOS SER A 5 ? UNP P41182 ? ? 'expression tag' 5 5 1 2EOS SER A 6 ? UNP P41182 ? ? 'expression tag' 6 6 1 2EOS GLY A 7 ? UNP P41182 ? ? 'expression tag' 7 7 1 2EOS SER A 37 ? UNP P41182 ? ? 'expression tag' 37 8 1 2EOS GLY A 38 ? UNP P41182 ? ? 'expression tag' 38 9 1 2EOS PRO A 39 ? UNP P41182 ? ? 'expression tag' 39 10 1 2EOS SER A 40 ? UNP P41182 ? ? 'expression tag' 40 11 1 2EOS SER A 41 ? UNP P41182 ? ? 'expression tag' 41 12 1 2EOS GLY A 42 ? UNP P41182 ? ? 'expression tag' 42 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id HIS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 23 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 31 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id HIS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 23 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 31 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 14 A ZN 201 1_555 ? ? ? ? ? ? ? 2.339 ? ? metalc2 metalc ? ? A CYS 17 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 17 A ZN 201 1_555 ? ? ? ? ? ? ? 2.206 ? ? metalc3 metalc ? ? A HIS 30 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 30 A ZN 201 1_555 ? ? ? ? ? ? ? 2.050 ? ? metalc4 metalc ? ? A HIS 34 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 34 A ZN 201 1_555 ? ? ? ? ? ? ? 1.957 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 17 ? A CYS 17 ? 1_555 114.0 ? 2 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 110.6 ? 3 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 112.3 ? 4 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 115.9 ? 5 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 105.7 ? 6 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 97.1 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -47.92 160.03 2 1 PRO A 11 ? ? -69.77 3.09 3 1 ILE A 16 ? ? -66.69 -72.61 4 1 GLN A 25 ? ? -34.78 -36.59 5 2 LYS A 10 ? ? -107.07 71.47 6 2 PRO A 11 ? ? -69.73 3.12 7 2 ILE A 16 ? ? -66.38 -71.94 8 2 GLN A 25 ? ? -39.07 -32.63 9 2 SER A 41 ? ? -50.07 99.36 10 3 SER A 5 ? ? -36.47 149.02 11 3 LYS A 10 ? ? 37.90 52.26 12 3 PRO A 11 ? ? -69.72 3.12 13 3 ILE A 16 ? ? -64.73 -71.83 14 3 PRO A 39 ? ? -69.82 1.99 15 4 SER A 3 ? ? -59.66 173.32 16 4 LYS A 10 ? ? -106.58 71.67 17 4 PRO A 11 ? ? -69.71 3.37 18 4 ILE A 16 ? ? -66.48 -72.85 19 4 GLN A 25 ? ? -34.24 -37.59 20 5 SER A 5 ? ? -102.20 42.78 21 5 LYS A 10 ? ? -106.84 72.48 22 5 PRO A 11 ? ? -69.79 3.62 23 5 ILE A 16 ? ? -66.22 -72.46 24 5 GLN A 25 ? ? -37.59 -29.22 25 5 SER A 41 ? ? -95.08 42.14 26 6 PRO A 11 ? ? -69.75 3.38 27 6 ILE A 16 ? ? -65.46 -72.56 28 6 THR A 19 ? ? -37.60 121.84 29 6 PRO A 39 ? ? -69.80 2.51 30 6 SER A 40 ? ? -80.84 44.13 31 6 SER A 41 ? ? -166.42 110.60 32 7 SER A 3 ? ? -66.11 80.20 33 7 PRO A 11 ? ? -69.78 3.96 34 7 ILE A 16 ? ? -66.70 -73.34 35 7 GLN A 25 ? ? -33.51 -35.41 36 7 PRO A 39 ? ? -69.76 2.71 37 7 SER A 40 ? ? -81.22 42.83 38 8 SER A 3 ? ? -162.24 117.90 39 8 LYS A 10 ? ? -109.38 73.63 40 8 PRO A 11 ? ? -69.77 3.05 41 8 ILE A 16 ? ? -66.75 -72.80 42 8 GLN A 25 ? ? -34.20 -36.53 43 8 SER A 40 ? ? -60.32 98.33 44 8 SER A 41 ? ? -37.21 152.23 45 9 GLU A 9 ? ? -54.68 -176.49 46 9 LYS A 10 ? ? -108.35 79.72 47 9 PRO A 11 ? ? -69.75 3.18 48 9 ILE A 16 ? ? -65.56 -72.46 49 9 GLN A 25 ? ? -36.16 -30.36 50 9 PRO A 39 ? ? -69.78 90.79 51 10 SER A 3 ? ? 38.03 42.62 52 10 LYS A 10 ? ? -109.89 67.81 53 10 PRO A 11 ? ? -69.74 3.53 54 10 ILE A 16 ? ? -68.62 -72.54 55 10 THR A 19 ? ? -39.35 135.68 56 10 THR A 35 ? ? -119.49 71.91 57 10 SER A 37 ? ? -167.50 117.46 58 11 LYS A 10 ? ? -106.56 71.94 59 11 PRO A 11 ? ? -69.75 3.30 60 11 ILE A 16 ? ? -66.30 -72.87 61 11 GLN A 25 ? ? -38.12 -27.55 62 12 LYS A 10 ? ? -107.06 71.14 63 12 PRO A 11 ? ? -69.79 4.43 64 12 ILE A 16 ? ? -67.85 -73.16 65 12 HIS A 34 ? ? -86.84 -72.42 66 13 GLU A 9 ? ? -163.24 110.31 67 13 PRO A 11 ? ? -69.74 3.63 68 13 ILE A 16 ? ? -64.22 -71.31 69 13 PRO A 39 ? ? -69.75 96.32 70 14 LYS A 10 ? ? -116.98 77.91 71 14 PRO A 11 ? ? -69.73 3.32 72 14 ILE A 16 ? ? -66.03 -71.93 73 14 GLN A 25 ? ? -37.34 -34.08 74 14 SER A 40 ? ? -39.96 97.50 75 15 PRO A 11 ? ? -69.79 4.49 76 15 ILE A 16 ? ? -63.93 -73.13 77 15 PRO A 39 ? ? -69.75 99.19 78 15 SER A 40 ? ? -94.58 42.19 79 16 SER A 5 ? ? -162.88 106.86 80 16 LYS A 10 ? ? -110.19 73.88 81 16 PRO A 11 ? ? -69.82 3.48 82 16 ILE A 16 ? ? -66.62 -72.59 83 16 GLN A 25 ? ? -37.17 -33.21 84 16 HIS A 34 ? ? -85.65 -74.05 85 16 SER A 41 ? ? -166.04 114.91 86 17 LYS A 10 ? ? -113.12 70.80 87 17 PRO A 11 ? ? -69.67 4.00 88 17 ILE A 16 ? ? -62.63 -73.09 89 17 GLN A 25 ? ? -36.66 -30.54 90 17 THR A 35 ? ? -108.98 76.43 91 17 PRO A 39 ? ? -69.71 2.10 92 17 SER A 40 ? ? -34.65 135.74 93 18 LYS A 10 ? ? -107.81 75.29 94 18 PRO A 11 ? ? -69.77 4.24 95 18 ILE A 16 ? ? -68.59 -73.78 96 18 THR A 19 ? ? -38.48 114.63 97 18 GLN A 25 ? ? -38.41 -30.59 98 19 LYS A 10 ? ? -106.76 72.28 99 19 PRO A 11 ? ? -69.75 3.23 100 19 ILE A 16 ? ? -66.13 -72.50 101 19 GLN A 25 ? ? -37.31 -31.31 102 19 SER A 40 ? ? -59.75 176.53 103 19 SER A 41 ? ? -41.24 160.74 104 20 PRO A 11 ? ? -69.78 3.87 105 20 ILE A 16 ? ? -67.14 -72.29 106 20 THR A 19 ? ? -37.96 123.99 107 20 ARG A 22 ? ? -36.60 -38.47 108 20 GLN A 25 ? ? -36.30 -39.02 109 20 SER A 40 ? ? -43.12 162.77 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.entry_id 2EOS _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2EOS # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 'about 1.0mM sample U-15N, 13C; 20mM d-Tris-HCl; 100mM NaCl; 0.05mM ZnCl2; 1mM IDA; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2EOS _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 CYS N N N N 28 CYS CA C N R 29 CYS C C N N 30 CYS O O N N 31 CYS CB C N N 32 CYS SG S N N 33 CYS OXT O N N 34 CYS H H N N 35 CYS H2 H N N 36 CYS HA H N N 37 CYS HB2 H N N 38 CYS HB3 H N N 39 CYS HG H N N 40 CYS HXT H N N 41 GLN N N N N 42 GLN CA C N S 43 GLN C C N N 44 GLN O O N N 45 GLN CB C N N 46 GLN CG C N N 47 GLN CD C N N 48 GLN OE1 O N N 49 GLN NE2 N N N 50 GLN OXT O N N 51 GLN H H N N 52 GLN H2 H N N 53 GLN HA H N N 54 GLN HB2 H N N 55 GLN HB3 H N N 56 GLN HG2 H N N 57 GLN HG3 H N N 58 GLN HE21 H N N 59 GLN HE22 H N N 60 GLN HXT H N N 61 GLU N N N N 62 GLU CA C N S 63 GLU C C N N 64 GLU O O N N 65 GLU CB C N N 66 GLU CG C N N 67 GLU CD C N N 68 GLU OE1 O N N 69 GLU OE2 O N N 70 GLU OXT O N N 71 GLU H H N N 72 GLU H2 H N N 73 GLU HA H N N 74 GLU HB2 H N N 75 GLU HB3 H N N 76 GLU HG2 H N N 77 GLU HG3 H N N 78 GLU HE2 H N N 79 GLU HXT H N N 80 GLY N N N N 81 GLY CA C N N 82 GLY C C N N 83 GLY O O N N 84 GLY OXT O N N 85 GLY H H N N 86 GLY H2 H N N 87 GLY HA2 H N N 88 GLY HA3 H N N 89 GLY HXT H N N 90 HIS N N N N 91 HIS CA C N S 92 HIS C C N N 93 HIS O O N N 94 HIS CB C N N 95 HIS CG C Y N 96 HIS ND1 N Y N 97 HIS CD2 C Y N 98 HIS CE1 C Y N 99 HIS NE2 N Y N 100 HIS OXT O N N 101 HIS H H N N 102 HIS H2 H N N 103 HIS HA H N N 104 HIS HB2 H N N 105 HIS HB3 H N N 106 HIS HD1 H N N 107 HIS HD2 H N N 108 HIS HE1 H N N 109 HIS HE2 H N N 110 HIS HXT H N N 111 ILE N N N N 112 ILE CA C N S 113 ILE C C N N 114 ILE O O N N 115 ILE CB C N S 116 ILE CG1 C N N 117 ILE CG2 C N N 118 ILE CD1 C N N 119 ILE OXT O N N 120 ILE H H N N 121 ILE H2 H N N 122 ILE HA H N N 123 ILE HB H N N 124 ILE HG12 H N N 125 ILE HG13 H N N 126 ILE HG21 H N N 127 ILE HG22 H N N 128 ILE HG23 H N N 129 ILE HD11 H N N 130 ILE HD12 H N N 131 ILE HD13 H N N 132 ILE HXT H N N 133 LEU N N N N 134 LEU CA C N S 135 LEU C C N N 136 LEU O O N N 137 LEU CB C N N 138 LEU CG C N N 139 LEU CD1 C N N 140 LEU CD2 C N N 141 LEU OXT O N N 142 LEU H H N N 143 LEU H2 H N N 144 LEU HA H N N 145 LEU HB2 H N N 146 LEU HB3 H N N 147 LEU HG H N N 148 LEU HD11 H N N 149 LEU HD12 H N N 150 LEU HD13 H N N 151 LEU HD21 H N N 152 LEU HD22 H N N 153 LEU HD23 H N N 154 LEU HXT H N N 155 LYS N N N N 156 LYS CA C N S 157 LYS C C N N 158 LYS O O N N 159 LYS CB C N N 160 LYS CG C N N 161 LYS CD C N N 162 LYS CE C N N 163 LYS NZ N N N 164 LYS OXT O N N 165 LYS H H N N 166 LYS H2 H N N 167 LYS HA H N N 168 LYS HB2 H N N 169 LYS HB3 H N N 170 LYS HG2 H N N 171 LYS HG3 H N N 172 LYS HD2 H N N 173 LYS HD3 H N N 174 LYS HE2 H N N 175 LYS HE3 H N N 176 LYS HZ1 H N N 177 LYS HZ2 H N N 178 LYS HZ3 H N N 179 LYS HXT H N N 180 PHE N N N N 181 PHE CA C N S 182 PHE C C N N 183 PHE O O N N 184 PHE CB C N N 185 PHE CG C Y N 186 PHE CD1 C Y N 187 PHE CD2 C Y N 188 PHE CE1 C Y N 189 PHE CE2 C Y N 190 PHE CZ C Y N 191 PHE OXT O N N 192 PHE H H N N 193 PHE H2 H N N 194 PHE HA H N N 195 PHE HB2 H N N 196 PHE HB3 H N N 197 PHE HD1 H N N 198 PHE HD2 H N N 199 PHE HE1 H N N 200 PHE HE2 H N N 201 PHE HZ H N N 202 PHE HXT H N N 203 PRO N N N N 204 PRO CA C N S 205 PRO C C N N 206 PRO O O N N 207 PRO CB C N N 208 PRO CG C N N 209 PRO CD C N N 210 PRO OXT O N N 211 PRO H H N N 212 PRO HA H N N 213 PRO HB2 H N N 214 PRO HB3 H N N 215 PRO HG2 H N N 216 PRO HG3 H N N 217 PRO HD2 H N N 218 PRO HD3 H N N 219 PRO HXT H N N 220 SER N N N N 221 SER CA C N S 222 SER C C N N 223 SER O O N N 224 SER CB C N N 225 SER OG O N N 226 SER OXT O N N 227 SER H H N N 228 SER H2 H N N 229 SER HA H N N 230 SER HB2 H N N 231 SER HB3 H N N 232 SER HG H N N 233 SER HXT H N N 234 THR N N N N 235 THR CA C N S 236 THR C C N N 237 THR O O N N 238 THR CB C N R 239 THR OG1 O N N 240 THR CG2 C N N 241 THR OXT O N N 242 THR H H N N 243 THR H2 H N N 244 THR HA H N N 245 THR HB H N N 246 THR HG1 H N N 247 THR HG21 H N N 248 THR HG22 H N N 249 THR HG23 H N N 250 THR HXT H N N 251 TYR N N N N 252 TYR CA C N S 253 TYR C C N N 254 TYR O O N N 255 TYR CB C N N 256 TYR CG C Y N 257 TYR CD1 C Y N 258 TYR CD2 C Y N 259 TYR CE1 C Y N 260 TYR CE2 C Y N 261 TYR CZ C Y N 262 TYR OH O N N 263 TYR OXT O N N 264 TYR H H N N 265 TYR H2 H N N 266 TYR HA H N N 267 TYR HB2 H N N 268 TYR HB3 H N N 269 TYR HD1 H N N 270 TYR HD2 H N N 271 TYR HE1 H N N 272 TYR HE2 H N N 273 TYR HH H N N 274 TYR HXT H N N 275 ZN ZN ZN N N 276 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 CYS N CA sing N N 27 CYS N H sing N N 28 CYS N H2 sing N N 29 CYS CA C sing N N 30 CYS CA CB sing N N 31 CYS CA HA sing N N 32 CYS C O doub N N 33 CYS C OXT sing N N 34 CYS CB SG sing N N 35 CYS CB HB2 sing N N 36 CYS CB HB3 sing N N 37 CYS SG HG sing N N 38 CYS OXT HXT sing N N 39 GLN N CA sing N N 40 GLN N H sing N N 41 GLN N H2 sing N N 42 GLN CA C sing N N 43 GLN CA CB sing N N 44 GLN CA HA sing N N 45 GLN C O doub N N 46 GLN C OXT sing N N 47 GLN CB CG sing N N 48 GLN CB HB2 sing N N 49 GLN CB HB3 sing N N 50 GLN CG CD sing N N 51 GLN CG HG2 sing N N 52 GLN CG HG3 sing N N 53 GLN CD OE1 doub N N 54 GLN CD NE2 sing N N 55 GLN NE2 HE21 sing N N 56 GLN NE2 HE22 sing N N 57 GLN OXT HXT sing N N 58 GLU N CA sing N N 59 GLU N H sing N N 60 GLU N H2 sing N N 61 GLU CA C sing N N 62 GLU CA CB sing N N 63 GLU CA HA sing N N 64 GLU C O doub N N 65 GLU C OXT sing N N 66 GLU CB CG sing N N 67 GLU CB HB2 sing N N 68 GLU CB HB3 sing N N 69 GLU CG CD sing N N 70 GLU CG HG2 sing N N 71 GLU CG HG3 sing N N 72 GLU CD OE1 doub N N 73 GLU CD OE2 sing N N 74 GLU OE2 HE2 sing N N 75 GLU OXT HXT sing N N 76 GLY N CA sing N N 77 GLY N H sing N N 78 GLY N H2 sing N N 79 GLY CA C sing N N 80 GLY CA HA2 sing N N 81 GLY CA HA3 sing N N 82 GLY C O doub N N 83 GLY C OXT sing N N 84 GLY OXT HXT sing N N 85 HIS N CA sing N N 86 HIS N H sing N N 87 HIS N H2 sing N N 88 HIS CA C sing N N 89 HIS CA CB sing N N 90 HIS CA HA sing N N 91 HIS C O doub N N 92 HIS C OXT sing N N 93 HIS CB CG sing N N 94 HIS CB HB2 sing N N 95 HIS CB HB3 sing N N 96 HIS CG ND1 sing Y N 97 HIS CG CD2 doub Y N 98 HIS ND1 CE1 doub Y N 99 HIS ND1 HD1 sing N N 100 HIS CD2 NE2 sing Y N 101 HIS CD2 HD2 sing N N 102 HIS CE1 NE2 sing Y N 103 HIS CE1 HE1 sing N N 104 HIS NE2 HE2 sing N N 105 HIS OXT HXT sing N N 106 ILE N CA sing N N 107 ILE N H sing N N 108 ILE N H2 sing N N 109 ILE CA C sing N N 110 ILE CA CB sing N N 111 ILE CA HA sing N N 112 ILE C O doub N N 113 ILE C OXT sing N N 114 ILE CB CG1 sing N N 115 ILE CB CG2 sing N N 116 ILE CB HB sing N N 117 ILE CG1 CD1 sing N N 118 ILE CG1 HG12 sing N N 119 ILE CG1 HG13 sing N N 120 ILE CG2 HG21 sing N N 121 ILE CG2 HG22 sing N N 122 ILE CG2 HG23 sing N N 123 ILE CD1 HD11 sing N N 124 ILE CD1 HD12 sing N N 125 ILE CD1 HD13 sing N N 126 ILE OXT HXT sing N N 127 LEU N CA sing N N 128 LEU N H sing N N 129 LEU N H2 sing N N 130 LEU CA C sing N N 131 LEU CA CB sing N N 132 LEU CA HA sing N N 133 LEU C O doub N N 134 LEU C OXT sing N N 135 LEU CB CG sing N N 136 LEU CB HB2 sing N N 137 LEU CB HB3 sing N N 138 LEU CG CD1 sing N N 139 LEU CG CD2 sing N N 140 LEU CG HG sing N N 141 LEU CD1 HD11 sing N N 142 LEU CD1 HD12 sing N N 143 LEU CD1 HD13 sing N N 144 LEU CD2 HD21 sing N N 145 LEU CD2 HD22 sing N N 146 LEU CD2 HD23 sing N N 147 LEU OXT HXT sing N N 148 LYS N CA sing N N 149 LYS N H sing N N 150 LYS N H2 sing N N 151 LYS CA C sing N N 152 LYS CA CB sing N N 153 LYS CA HA sing N N 154 LYS C O doub N N 155 LYS C OXT sing N N 156 LYS CB CG sing N N 157 LYS CB HB2 sing N N 158 LYS CB HB3 sing N N 159 LYS CG CD sing N N 160 LYS CG HG2 sing N N 161 LYS CG HG3 sing N N 162 LYS CD CE sing N N 163 LYS CD HD2 sing N N 164 LYS CD HD3 sing N N 165 LYS CE NZ sing N N 166 LYS CE HE2 sing N N 167 LYS CE HE3 sing N N 168 LYS NZ HZ1 sing N N 169 LYS NZ HZ2 sing N N 170 LYS NZ HZ3 sing N N 171 LYS OXT HXT sing N N 172 PHE N CA sing N N 173 PHE N H sing N N 174 PHE N H2 sing N N 175 PHE CA C sing N N 176 PHE CA CB sing N N 177 PHE CA HA sing N N 178 PHE C O doub N N 179 PHE C OXT sing N N 180 PHE CB CG sing N N 181 PHE CB HB2 sing N N 182 PHE CB HB3 sing N N 183 PHE CG CD1 doub Y N 184 PHE CG CD2 sing Y N 185 PHE CD1 CE1 sing Y N 186 PHE CD1 HD1 sing N N 187 PHE CD2 CE2 doub Y N 188 PHE CD2 HD2 sing N N 189 PHE CE1 CZ doub Y N 190 PHE CE1 HE1 sing N N 191 PHE CE2 CZ sing Y N 192 PHE CE2 HE2 sing N N 193 PHE CZ HZ sing N N 194 PHE OXT HXT sing N N 195 PRO N CA sing N N 196 PRO N CD sing N N 197 PRO N H sing N N 198 PRO CA C sing N N 199 PRO CA CB sing N N 200 PRO CA HA sing N N 201 PRO C O doub N N 202 PRO C OXT sing N N 203 PRO CB CG sing N N 204 PRO CB HB2 sing N N 205 PRO CB HB3 sing N N 206 PRO CG CD sing N N 207 PRO CG HG2 sing N N 208 PRO CG HG3 sing N N 209 PRO CD HD2 sing N N 210 PRO CD HD3 sing N N 211 PRO OXT HXT sing N N 212 SER N CA sing N N 213 SER N H sing N N 214 SER N H2 sing N N 215 SER CA C sing N N 216 SER CA CB sing N N 217 SER CA HA sing N N 218 SER C O doub N N 219 SER C OXT sing N N 220 SER CB OG sing N N 221 SER CB HB2 sing N N 222 SER CB HB3 sing N N 223 SER OG HG sing N N 224 SER OXT HXT sing N N 225 THR N CA sing N N 226 THR N H sing N N 227 THR N H2 sing N N 228 THR CA C sing N N 229 THR CA CB sing N N 230 THR CA HA sing N N 231 THR C O doub N N 232 THR C OXT sing N N 233 THR CB OG1 sing N N 234 THR CB CG2 sing N N 235 THR CB HB sing N N 236 THR OG1 HG1 sing N N 237 THR CG2 HG21 sing N N 238 THR CG2 HG22 sing N N 239 THR CG2 HG23 sing N N 240 THR OXT HXT sing N N 241 TYR N CA sing N N 242 TYR N H sing N N 243 TYR N H2 sing N N 244 TYR CA C sing N N 245 TYR CA CB sing N N 246 TYR CA HA sing N N 247 TYR C O doub N N 248 TYR C OXT sing N N 249 TYR CB CG sing N N 250 TYR CB HB2 sing N N 251 TYR CB HB3 sing N N 252 TYR CG CD1 doub Y N 253 TYR CG CD2 sing Y N 254 TYR CD1 CE1 sing Y N 255 TYR CD1 HD1 sing N N 256 TYR CD2 CE2 doub Y N 257 TYR CD2 HD2 sing N N 258 TYR CE1 CZ doub Y N 259 TYR CE1 HE1 sing N N 260 TYR CE2 CZ sing Y N 261 TYR CE2 HE2 sing N N 262 TYR CZ OH sing N N 263 TYR OH HH sing N N 264 TYR OXT HXT sing N N 265 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2EOS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_